#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xbi assembly_id=1

Protein Model on 6xbi assembly_id=1 (TEMPLATE: 6xbi assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [307 aa] main protease :R1AB_SARS2
2 b B 1 (B) polymer(polypeptide(L)) [304 aa] main protease :R1AB_SARS2 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 141L 166E 168P 169T 170G 280T 283G 285A 286L 290E 299Q 300C 301S 302G 303V 304T 305F 306Q (identity: 100.0 %/100.0 %)
3 c C 1 (D) polymer(polypeptide(L)) [5 aa] inhibitor UAW248 25T 26T 41H 49M 140F 142N 143G 144S 145C 163H 164H 165M 166E 168P 172H 187D 189Q 190T 191A 192Q (identity: 100.0 %/100.0 %)
4 d D 1 (E) polymer(polypeptide(L)) [5 aa] inhibitor UAW248
5 e E 1 (A) non-polymer(GOL) GLYCEROL 227L 228N 231N 232L (identity: 100.0 %/100.0 %)
6 f F 1 (A) non-polymer(GOL) GLYCEROL 83Q 103F 178E (identity: 100.0 %/100.0 %)
7 g G 1 (A) non-polymer(NA) SODIUM ION 226T 227L 262L (identity: 100.0 %/100.0 %)
8 h H 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE 123S 124G (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xbi_A_1 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6xbi_A_1       3:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 102
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTS SS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeebeeeebebebeeeebebeeeebeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbb  b          cc              c       c                                 f                 

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6xbi_A_1     103:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 202
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbbbeebbbbbbbbbbbebeeebbbbbbbbbebbeebebeeeebeeeeebeb:    
Contact         :  f                  bbbbbbb        bbbcbcccc                 cccb bbb c     f        c cccc        
Contact         :                      hh                                         c c                                

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6xbi_A_1     203:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 302
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHHHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbebeeeebeeeeebeeeebeebbeeeebbebeeebbeebeebbeeeebebeebbbbbeebbeeebeeeebbebeeeebbbbbebbebee:    
Contact         :                         gee  ee                             g                 b  b bb   b        bb
Contact         :                          g                                                                         

queryA       301:SGVTFQ: 306
                :******:
6xbi_A_1     303:SGVTFQ: 308
SecStr          :HT    :    
ExpBur          :eeeebe:    
Contact         :bbbbbb                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123