#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xmk assembly_id=1

Protein Model on 6xmk assembly_id=1 (TEMPLATE: 6xmk assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [298 aa] 3C-like proteinase :R1AB_SARS2 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 139S 141L 299Q 302G (identity: 100.0 %/100.0 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [302 aa] 3C-like proteinase :R1AB_SARS2
3 c C 1 (A) non-polymer(QYS) (1S,2S)-2-[(N-{[(4,4-difluorocyclohexyl)methoxy]carbonyl}-L-leucyl)amino]-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid
4 d D 1 (B) non-polymer(QYS) (1S,2S)-2-[(N-{[(4,4-difluorocyclohexyl)methoxy]carbonyl}-L-leucyl)amino]-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 41H 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 168P 172H 187D 188R 189Q 190T 191A (identity: 100.0 %/100.0 %)
5 e E 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 14E 15G 17M 31W 70A 73V 75L 95N (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:6xmk_B_1 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6xmk_B_1       5:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 104
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  STTSSS  HHHHHHH  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeebbeebebeeebeebeeeebebbeeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :   aaaaaaaa  ae e             e         d                            e  e e                   e     
Contact         :             e                                                                                      

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6xmk_B_1     105:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 204
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :                     aaaaaaa        a adadddd                 dddd d   d              ddddd         
Contact         :                                        d                                                           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6xmk_B_1     205:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 304
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbeebeeeebeebeeebeeebeebbeeeebebeebbbbbbebbeeebeeeebbeeeeeebebbbebbeeee:    
Contact         :                                                                                                  a 

queryA       301:SG: 302
                :**:
6xmk_B_1     305:SG: 306
SecStr          :H :    
ExpBur          :ee:    
Contact         : a                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123