#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xqs assembly_id=1

Protein Model on 6xqs assembly_id=1 (TEMPLATE: 6xqs assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 283G 285A 286L 290E 299Q 300C 301S 302G 303V 304T 305F (identity: 100.0 %/100.0 %)
3 c B 1 (A) non-polymer(SV6) (1S,3aR,6aS)-2-[(2S)-2-({(2S)-2-cyclohexyl-2-[(pyrazin-2-ylcarbonyl)amino]acetyl}amino)-3,3-dimethylbutanoyl]-N-[(2R,3S)-1-(cyclopropylamino)-2-hydroxy-1-oxohexan-3-yl]octahydrocyclopenta[c]pyrrole-1-carboxamide 26T 27L 41H 49M 142N 143G 144S 145C 164H 165M 166E 167L 168P 187D 188R 189Q 190T 191A 192Q (identity: 100.0 %/100.0 %)
4 d B 2 (A) non-polymer(SV6) (1S,3aR,6aS)-2-[(2S)-2-({(2S)-2-cyclohexyl-2-[(pyrazin-2-ylcarbonyl)amino]acetyl}amino)-3,3-dimethylbutanoyl]-N-[(2R,3S)-1-(cyclopropylamino)-2-hydroxy-1-oxohexan-3-yl]octahydrocyclopenta[c]pyrrole-1-carboxamide
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xqs_A_1 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6xqs_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bbbbbbbbbbb  b           cc             c       c                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6xqs_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeebeb:    
Contact         :                 b  bbbbbbbb        bbbbbcccc                  ccbcc b b              cccccc        
Contact         :                                                                 c                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6xqs_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebebeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbeebbeeebeeeebeeeeeebbbbbbebbebbe:    
Contact         :                                                                                  b bb   b        bb

queryA       301:SGVTFQ: 306
                :******:
6xqs_A_1     301:SGVTFQ: 306
SecStr          :HT    :    
ExpBur          :eeeeee:    
Contact         :bbbbb                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123