#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xqt assembly_id=1

Protein Model on 6xqt assembly_id=1 (TEMPLATE: 6xqt assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 172H 280T 283G 285A 286L 290E 299Q 300C 301S 302G 303V 304T 305F 306Q (identity: 100.0 %/100.0 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2
3 c C 1 (A) non-polymer(NNA) (1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cyclohexyl}carbamoyl)-3-methyl-L-valyl]-N-{(1S)-1-[(1R)-2-(cyclopropyla mino)-1-hydroxy-2-oxoethyl]pentyl}-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide
4 d D 1 (B) non-polymer(NNA) (1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cyclohexyl}carbamoyl)-3-methyl-L-valyl]-N-{(1S)-1-[(1R)-2-(cyclopropyla mino)-1-hydroxy-2-oxoethyl]pentyl}-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide 26T 41H 49M 54Y 141L 142N 143G 144S 145C 163H 164H 165M 166E 167L 168P 185F 186V 187D 188R 189Q 190T 191A 192Q (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:6xqt_B_1 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6xqt_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TGGGSS  HHHHHHT  GGGEEEEETTEEEEEEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbebebeeeebbbbbbeebbbbbbbbbbeeeeeeebebeeebeeeeeeebebeeeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aa aaaaaaaa  a           d              d       d    d                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6xqt_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbeebeeebbbbbbbebebbeebebeeeeeeeeeeeeb:    
Contact         :                    aaaaaaaa        aaaaadddd                 dddadd   a            dddddddd        
Contact         :                                        d                        d                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6xqt_B_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHHT  TT  S    SSHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  SS  BTTBSS      HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbeeeeeebbbeeebeeeebbebbeeeebeebeeeebeebeebeeebebebeebbbbbbebbeeebeeeebeeeeeeebbbbbebbebee:    
Contact         :                                                                               a  a aa   a        aa

queryA       301:SGVTFQ: 306
                :******:
6xqt_B_1     301:SGVTFQ: 306
SecStr          :TT    :    
ExpBur          :eeeeee:    
Contact         :aaaaaa                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123