#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6ynq assembly_id=1

Protein Model on 6ynq assembly_id=1 (TEMPLATE: 6ynq assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_SARS2
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_SARS2 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 170G 172H 283G 285A 286L 290E 298R 299Q 300C 301S 302G 303V 304T 305F (identity: 100.0 %/100.0 %)
3 c B 1 (A) non-polymer(P6N) (2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-one 140F 141L 142N 144S 145C 163H 164H 166E (identity: 100.0 %/100.0 %)
4 d B 2 (A) non-polymer(P6N) (2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-one 1S (identity: 100.0 %/100.0 %)
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 75L 76R (identity: 100.0 %/100.0 %)
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
7 g D 1 (A) non-polymer(CL) CHLORIDE ION 5K (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(CL) CHLORIDE ION 5K (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6ynq_A_1 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6ynq_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeebbebeebeebbbebbbeeebbbbbbbeebbbbbbbbbbeeebbeebebeeebeebeeeebebebeeeebebeeeebeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbb  b                                                            ee                        
Contact         :d   g                                                                                               
Contact         :    h                                                                                               

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6ynq_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeebbbbbbbbbbeeebbbbbbbbbbebeeeebbbbbbebebbeebebeeeebeeeeeebb:    
Contact         :                 b  bbbbbbb         bbbbbc cc                 cc b   b b                            
Contact         :                                       cc                        c                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6ynq_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbebeeeebeeeeebebeebbebbeeeebeebeeebbeebeebbeebebebeebbbbbbbbbeeebeeeebbebeebbbbbbbebbebbe:    
Contact         :                                                                                  b bb   b       bbb

queryA       301:SGVTFQ: 306
                :******:
6ynq_A_1     301:SGVTFQ: 306
SecStr          :HT    :    
ExpBur          :eeeebe:    
Contact         :bbbbb                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123