#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6yt8 assembly_id=1

Protein Model on 6yt8 assembly_id=1 (TEMPLATE: 6yt8 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_SARS2 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 172H 283G 285A 286L 290E 298R 299Q 300C 301S 302G 303V 304T 305F (identity: 100.0 %/100.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_SARS2
3 c B 1 (A) non-polymer(PK8) 9-oxa-7-thia-1-azonia-8$l^{2}-zincabicyclo[4.3.0]nona-1,3,5-triene
4 d B 2 (A) non-polymer(PK8) 9-oxa-7-thia-1-azonia-8$l^{2}-zincabicyclo[4.3.0]nona-1,3,5-triene 26T 27L 41H 142N 145C 164H (identity: 100.0 %/100.0 %)
5 e C 1 (A) non-polymer(IMD) IMIDAZOLE
6 f C 2 (A) non-polymer(IMD) IMIDAZOLE 222R 223F 224T 263D (identity: 100.0 %/100.0 %)
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 140F 141L 142N 144S 145C 163H 164H 165M 166E (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
10 j E 2 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 199T 237Y 239Y 271L 272L (identity: 100.0 %/100.0 %)
11 k F 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
12 l F 2 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 108P 109G 110Q 200I 202V 240E 246H (identity: 100.0 %/100.0 %)
13 m G 1 (A) non-polymer(CL) CHLORIDE ION
14 n G 2 (A) non-polymer(CL) CHLORIDE ION 111T 127Q 290E 291F 295D (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:6yt8_A_2 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6yt8_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeebbebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeebbeebebeeebeebeeeebebebeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  a           dd             d                                                           

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6yt8_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :beeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeeebbbbbbebebbeebebeeeebeeeeeebb:    
Contact         :       llln      a  aaaaaaa         aaaaad hd                 hdha     a                          jl
Contact         :                          n            hhh  h                  h h                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6yt8_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHH   HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbebbbeeebeeeebbebeebebebbbebbebbe:    
Contact         : l                   fff            j jl     l                f       jj          a aa   an   n  aaa
Contact         :                                                                                         n          

queryA       301:SGVTFQ: 306
                :******:
6yt8_A_2     301:SGVTFQ: 306
SecStr          :TT    :    
ExpBur          :eeeeee:    
Contact         :aaaaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123