#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6yvf assembly_id=1

Protein Model on 6yvf assembly_id=1 (TEMPLATE: 6yvf assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_SARS2
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_SARS2 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 170G 172H 280T 283G 285A 286L 290E 298R 299Q 300C 301S 302G 303V 304T 305F (identity: 100.0 %/100.0 %)
3 c B 1 (A) non-polymer(A82) 2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylidene-pyrido[1,2-a]pyrimidin-9-yl)ethyl]amino]benzoic acid 63N 78I 79G 80H 81S 88K 90K (identity: 100.0 %/100.0 %)
4 d B 2 (A) non-polymer(A82) 2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylidene-pyrido[1,2-a]pyrimidin-9-yl)ethyl]amino]benzoic acid
5 e C 1 (A) non-polymer(CL) CHLORIDE ION 15G 31W 95N 96P 97K (identity: 100.0 %/100.0 %)
6 f C 2 (A) non-polymer(CL) CHLORIDE ION
7 g D 1 (A) non-polymer(CL) CHLORIDE ION 14E (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(CL) CHLORIDE ION 9P 10S 11G 12K (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 74Q 75L 76R (identity: 100.0 %/100.0 %)
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 15G 17M 97K (identity: 100.0 %/100.0 %)
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
13 m G 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 140F 141L 142N 144S 163H 165M 166E (identity: 100.0 %/100.0 %)
14 n G 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 1S (identity: 100.0 %/100.0 %)
15 o H 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 101Y 103F (identity: 100.0 %/100.0 %)
16 p H 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
17 q I 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 23G 64H 65N 67L (identity: 100.0 %/100.0 %)
18 r I 2 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
19 s J 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 61K 62S (identity: 100.0 %/100.0 %)
20 t J 2 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
21 u K 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 238N (identity: 100.0 %/100.0 %)
22 v K 2 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
23 w L 1 (A) non-polymer(CA) CALCIUM ION 100K (identity: 100.0 %/100.0 %)
24 x L 2 (A) non-polymer(CA) CALCIUM ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6yvf_A_1 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6yvf_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTTS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbebbbeeeebbbbbbeeebbbbbbbbbeeebbeebebeeebeeeeeeebebebeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbbh be k     q       e                             sscqq q      iii cccc      c c    eee  w
Contact         :n       hhh  gk                                                                                 k   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6yvf_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SS SS       B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :o o              b  bbbbbbb         bbbbbm m                  m mb   b b                            
Contact         :                                       mm                        m                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6yvf_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHTTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebbebeeebbeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbebbe:    
Contact         :                                     u                                         b  b bb   b       bbb

queryA       301:SGVTFQ: 306
                :******:
6yvf_A_1     301:SGVTFQ: 306
SecStr          :HT    :    
ExpBur          :eeeeee:    
Contact         :bbbbb                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123