#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6z2e assembly_id=1

Protein Model on 6z2e assembly_id=1 (TEMPLATE: 6z2e assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (AAA) polymer(polypeptide(L)) [306 aa] Main Protease :R1AB_SARS2
2 b A 2 (AAA) polymer(polypeptide(L)) [306 aa] Main Protease :R1AB_SARS2 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 119N 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 142N 166E 170G 172H 283G 285A 286L 290E 298R 299Q 300C 301S 303V 304T 305F 306Q (identity: 100.0 %/100.0 %)
3 c B 1 (AAA) non-polymer(Q5T) (4~{S})-4-[[(2~{S})-2-[[(2~{S})-2-[[(2~{S})-2-[3-[2-[2-[2-[2-[5-[(3~{a}~{S},4~{R},6~{a}~{R})-2-oxidanylidene-3,3~{a},4,6~{a}-tetrahydro-1~{H}-thieno[3,4-d]imidazol-4-yl]pentanoylamino]ethoxy]ethoxy]ethoxy]ethoxy]propanoylamino]butanoyl]amino]-3,3-dimethyl-butanoyl]amino]-4-methyl-pentanoyl]amino]-6-methylsulfonyl-hexanamide 25T 26T 27L 41H 51N 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 172H 188R 189Q 190T 191A 192Q (identity: 100.0 %/100.0 %)
4 d B 2 (AAA) non-polymer(Q5T) (4~{S})-4-[[(2~{S})-2-[[(2~{S})-2-[[(2~{S})-2-[3-[2-[2-[2-[2-[5-[(3~{a}~{S},4~{R},6~{a}~{R})-2-oxidanylidene-3,3~{a},4,6~{a}-tetrahydro-1~{H}-thieno[3,4-d]imidazol-4-yl]pentanoylamino]ethoxy]ethoxy]ethoxy]ethoxy]propanoylamino]butanoyl]amino]-3,3-dimethyl-butanoyl]amino]-4-methyl-pentanoyl]amino]-6-methylsulfonyl-hexanamide
5 e C 1 (AAA) non-polymer(CL) CHLORIDE ION 284S 285A 286L (identity: 100.0 %/100.0 %)
6 f C 2 (AAA) non-polymer(CL) CHLORIDE ION 284S 285A 286L (identity: 100.0 %/100.0 %)
7 g D 1 (AAA) non-polymer(CL) CHLORIDE ION 200I 201T 202V 240E 246H (identity: 100.0 %/100.0 %)
8 h D 2 (AAA) non-polymer(CL) CHLORIDE ION
9 i E 1 (AAA) non-polymer(NA) SODIUM ION 241P 242L 243T 246H (identity: 100.0 %/100.0 %)
10 j E 2 (AAA) non-polymer(NA) SODIUM ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6z2e_A_1 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6z2e_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEE SS EEEEEEETTEEEEEGGGGS GGG SS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbebeebebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbb  b          ccc             c         c                                                 

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6z2e_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeebbbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :                 bb bbbbbbbb        bbbbbbccc                 cccb   b b               ccccc       g
Contact         :                                       ccc                       c     c                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6z2e_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbebbe:    
Contact         :gg                                     giii  g                                    bebb   b       bbb
Contact         :                                             i                                     fee              
Contact         :                                                                                    ff              

queryA       301:SGVTFQ: 306
                :******:
6z2e_A_1     301:SGVTFQ: 306
SecStr          :TGGGG :    
ExpBur          :eeeeee:    
Contact         :b bbbb                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123