#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6zru assembly_id=1

Protein Model on 6zru assembly_id=1 (TEMPLATE: 6zru assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] Main Protease :R1AB_SARS2
2 b A 2 (A) polymer(polypeptide(L)) [304 aa] Main Protease :R1AB_SARS2 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 172H 280T 283G 285A 286L 290E 299Q 300C 301S 302G 303V 304T (identity: 100.0 %/100.0 %)
3 c B 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 74Q 76R (identity: 100.0 %/100.0 %)
4 d B 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 6M 7A 8F 127Q (identity: 100.0 %/100.0 %)
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 123S (identity: 100.0 %/100.0 %)
7 g D 1 (A) non-polymer(U5G) boceprevir (bound form) 41H 49M 54Y 142N 143G 144S 145C 164H 165M 166E 167L 168P 187D 188R 189Q 190T 192Q (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(U5G) boceprevir (bound form)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6zru_A_1 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6zru_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeeeebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bbbbbbbbbbb  b                          g       g    g                   c c                        
Contact         :     eee                                                                                            

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6zru_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEETTTEEEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeeeeb:    
Contact         :                 b  bbbbbbb         bbbbbgggg                  ggbgg   b              gggg g        
Contact         :                      f   e                                      g                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6zru_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbebeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebeeebebebeebbbbbbebbeeebeeeebeeeeeeebbbbbebbeeee:    
Contact         :                                                                               b  b bb   b        bb

queryA       301:SGVT: 304
                :****:
6zru_A_1     301:SGVT: 304
SecStr          :HT  :    
ExpBur          :eeee:    
Contact         :bbbb                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123