#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7c7p assembly_id=1

Protein Model on 7c7p assembly_id=1 (TEMPLATE: 7c7p assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [301 aa] main protease :R1AB_SARS2 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 172H 280T 283G 285A 286L 290E 298R 299Q 300C 301S 302G 303V 304T 305F (identity: 100.0 %/98.0 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [300 aa] main protease :R1AB_SARS2
3 c C 1 (A) non-polymer(SV6) (1S,3aR,6aS)-2-[(2S)-2-({(2S)-2-cyclohexyl-2-[(pyrazin-2-ylcarbonyl)amino]acetyl}amino)-3,3-dimethylbutanoyl]-N-[(2R,3S)-1-(cyclopropylamino)-2-hydroxy-1-oxohexan-3-yl]octahydrocyclopenta[c]pyrrole-1-carboxamide
4 d D 1 (A) non-polymer(CL) CHLORIDE ION
5 e E 1 (B) non-polymer(FK3) (3~{S},3~{a}~{S},6~{a}~{R})-~{N}-[(2~{R},3~{S})-1-(cyclopropylamino)-2-oxidanyl-1-oxidanylidene-hexan-3-yl]-2-methanoyl-3,3~{a},4,5,6,6~{a}-hexahydro-1~{H}-cyclopenta[c]pyrrole-3-carboxamide 25T 26T 27L 41H 142N 143G 144S 145C 164H 165M 187D 188R 189Q (identity: 100.0 %/98.0 %)
6 f F 1 (B) non-polymer(CL) CHLORIDE ION 4R 5K (identity: 100.0 %/98.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:7c7p_B_1 identity=98.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :*********************************************      *************************************************:
7c7p_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTXXXXXXPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  ------  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbee------eebeebbeeeeeeebebeeeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aa aaaaaaaa  a          eee             e                                                           
Contact         :   ff                                                                                               

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
7c7p_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :                     aaaaaaa        aaaaaeeee                  eea     a              eee           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
7c7p_B_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHHHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebeeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbebbe:    
Contact         :                                                                               a  a aa   a       aaa

queryA       301:SGVTFQ: 306
                :******:
7c7p_B_1     301:SGVTFQ: 306
SecStr          :HT    :    
ExpBur          :eeeeee:    
Contact         :aaaaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123