#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7c8t assembly_id=1

Protein Model on 7c8t assembly_id=1 (TEMPLATE: 7c8t assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 119N 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 142N 166E 170G 172H 280T 283G 285A 286L 290E 298R 299Q 300C 303V 304T 305F 306Q (identity: 100.0 %/100.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2
3 c B 1 (A) non-polymer(NOL) N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-3-CYCLOHEXYL-N-[(1S)-2-HYDROXY-1-{[(3S)-2-OXOPYRROLIDIN-3-YL]METHYL}ETHYL]-L-ALANINAMIDE
4 d B 2 (A) non-polymer(NOL) N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-3-CYCLOHEXYL-N-[(1S)-2-HYDROXY-1-{[(3S)-2-OXOPYRROLIDIN-3-YL]METHYL}ETHYL]-L-ALANINAMIDE 41H 44C 49M 54Y 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 167L 168P 172H 187D 188R 189Q 190T 191A 192Q (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:7c8t_A_2 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
7c8t_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  SSTTSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeeeeeeebebebeeeebebebeebeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  a                          d  d    d    d                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
7c8t_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEETTTEEEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeeeeb:    
Contact         :                 aa aaaaaaaa        aaaaaaddd                 dddadd a a              dddddd        
Contact         :                                       ddd                       d     d                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
7c8t_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  SS  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebebeeebebeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbeebbeeebeeeebeebeebebbbbbebbebbe:    
Contact         :                                                                               a  a aa   a       aaa

queryA       301:SGVTFQ: 306
                :******:
7c8t_A_2     301:SGVTFQ: 306
SecStr          :TGGGG :    
ExpBur          :eeeeee:    
Contact         :  aaaa                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123