#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7cx9 assembly_id=1

Protein Model on 7cx9 assembly_id=1 (TEMPLATE: 7cx9 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [295 aa] 3C protein :R1AB_SARS2 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 283G 285A 286L 290E 298R 299Q (identity: 100.0 %/98.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [295 aa] 3C protein :R1AB_SARS2
3 c B 1 (A) non-polymer(GKF) 3-iodanyl-1~{H}-indazole-7-carbaldehyde
4 d B 2 (A) non-polymer(GKF) 3-iodanyl-1~{H}-indazole-7-carbaldehyde 41H 145C 164H 165M 187D 188R 189Q (identity: 100.0 %/98.0 %)
5 e C 1 (A) non-polymer(GOL) GLYCEROL
6 f C 2 (A) non-polymer(GOL) GLYCEROL 140F 141L 142N 143G 144S 145C 163H 164H 166E (identity: 100.0 %/98.0 %)
7 g D 1 (A) non-polymer(CL) CHLORIDE ION
8 h D 2 (A) non-polymer(CL) CHLORIDE ION 100K 101Y (identity: 100.0 %/98.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:7cx9_A_2 identity=98.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************************      **************************************************:
7cx9_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICXXXXXXNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG ------   HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbe------eeebeeebeeeeeeebebebeeeebebeeeebeebbbebebeeebeeebe:    
Contact         :aa aaaaaaaa  a                          d                                                          h

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
7cx9_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS SS       B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :h                    aaaaaaa        aaaaafffd                 fdda   a a              ddd           
Contact         :                                       ff   f                  f f                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
7cx9_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHH :    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeeb:    
Contact         :                                                                                  a aa   a       aa 

queryA       301:S: 301
                :*:
7cx9_A_2     301:S: 301
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123