#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7jyc assembly_id=1

Protein Model on 7jyc assembly_id=1 (TEMPLATE: 7jyc assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 172H 280T 283G 285A 286L 299Q 302G 303V 304T 305F (identity: 100.0 %/100.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2
3 c B 1 (A) non-polymer(NNA) (1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cyclohexyl}carbamoyl)-3-methyl-L-valyl]-N-{(1S)-1-[(1R)-2-(cyclopropyla mino)-1-hydroxy-2-oxoethyl]pentyl}-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide
4 d B 2 (A) non-polymer(NNA) (1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cyclohexyl}carbamoyl)-3-methyl-L-valyl]-N-{(1S)-1-[(1R)-2-(cyclopropyla mino)-1-hydroxy-2-oxoethyl]pentyl}-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide 25T 26T 41H 49M 54Y 140F 141L 142N 143G 144S 145C 164H 165M 166E 167L 168P 186V 187D 188R 189Q 190T 191A 192Q (identity: 100.0 %/100.0 %)
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 74Q 75L 76R (identity: 100.0 %/100.0 %)
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 64H 65N (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 123S (identity: 100.0 %/100.0 %)
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 6M 7A 8F 127Q 298R (identity: 100.0 %/100.0 %)
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 14E 15G 17M 70A 97K (identity: 100.0 %/100.0 %)
13 m G 1 (A) non-polymer(NA) SODIUM ION 284S 285A 286L (identity: 100.0 %/100.0 %)
14 n G 2 (A) non-polymer(NA) SODIUM ION 284S 285A 286L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:7jyc_A_2 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
7jyc_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHTT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeebeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  al l       dd              d       d    d         hh    l   fff                    l   
Contact         :     jjj     l                                                                                      

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
7jyc_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeeebb:    
Contact         :                 a  aaaaaaaa        aaaaadddd                  ddadd   a             ddddddd        
Contact         :                      i   j            dd                        d                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
7jyc_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeebbeebeebeeeeebebeebbbbbbebbeeebeeeebeeeeebebbbbbebbeeee:    
Contact         :                                                                               a  amaa           ja 
Contact         :                                                                                   nmm              
Contact         :                                                                                    nn              

queryA       301:SGVTFQ: 306
                :******:
7jyc_A_2     301:SGVTFQ: 306
SecStr          :H     :    
ExpBur          :eeeeee:    
Contact         : aaaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123