#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7k3t assembly_id=1

Protein Model on 7k3t assembly_id=1 (TEMPLATE: 7k3t assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description m(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 97K 118Y 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 172H 280T 283G 285A 286L 290E 299Q 300C 301S 302G 303V 304T 305F (identity: 100.0 %/100.0 %)
2 b B 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
3 c C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
4 d D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 123S (identity: 100.0 %/100.0 %)
5 e E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
6 f F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 1S (identity: 100.0 %/100.0 %)
7 g G 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
8 h H 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
9 i I 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
10 j J 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
11 k K 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
12 l L 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
13 m A(queryA) A 2 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2
14 n B 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 74Q 75L 76R (identity: 100.0 %/100.0 %)
15 o C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 64H 65N (identity: 100.0 %/100.0 %)
16 p D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 6M 7A 8F 127Q 295D 298R (identity: 100.0 %/100.0 %)
17 q E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 132P 133N 196T 198T 240E (identity: 100.0 %/100.0 %)
18 r F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 140F 141L 142N 144S 145C 163H 165M 166E 172H (identity: 100.0 %/100.0 %)
19 s G 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 14E 15G 17M 31W (identity: 100.0 %/100.0 %)
20 t H 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 100K 101Y (identity: 100.0 %/100.0 %)
21 u I 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 40R 84N 85C (identity: 100.0 %/100.0 %)
22 v J 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 82M 83Q 84N (identity: 100.0 %/100.0 %)
23 w K 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 272L 273Q 274N 275G (identity: 100.0 %/100.0 %)
24 x L 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 37Y 101Y 103F (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[13] Protein A "queryA" TEMPLATE:7k3t_A_2 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
7k3t_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHTT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeeebeeeeeeebebebeeeebebeeeebeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  as s             s     x  u                       oo        nnn     vvuu           a  t
Contact         :f    ppp     s                                                                     v                

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********* ******************************************************************************************:
7k3t_A_2     101:YKFVRIQPGXTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE      - EEEEEEETTEEEEEEEE   TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeeb-bbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeebbbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :t x              a  aaaaaaaa   qq   aaaaar rr                 r ra     a                       q q  
Contact         :x                     d   p            rr                        r     r                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
7k3t_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbeebeeeebeeeeebebeebeebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeee:    
Contact         :                                       q                               wwww    a  a aa   a    p  paa

queryA       301:SGVTFQ: 306
                :******:
7k3t_A_2     301:SGVTFQ: 306
SecStr          :HT    :    
ExpBur          :eeeeee:    
Contact         :aaaaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123