#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1lvo assembly_id=2

Protein Model on 1lvo assembly_id=2 (TEMPLATE: 1lvo assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU
2 b D 1 (D) polymer(polypeptide(L)) [301 aa] Replicase, hydrolase domain :R1AB_CVPPU 1S 2G 4R 6M 7A 8F(Q) 9P 10S 11G 14E 122P 123S(G) 124G(S) 125V 126Y 137K 138G 139S 141L(I) 278G 280T 283G(S) 284S(Y) 285A(G) 299Q 300C(M) 301S(Y) 302G (identity: 67.9 %/45.2 %)
3 c V 1 (C) non-polymer(SO4) SULFATE ION 176D(N) 180N(E) (identity: 0.0 %/45.2 %)
4 d W 1 (C) non-polymer(SO4) SULFATE ION 131R 197D(N) (identity: 50.0 %/45.2 %)
5 e X 1 (C) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/45.2 %)
6 f Y 1 (C) non-polymer(SO4) SULFATE ION 279R 280T (identity: 100.0 %/45.2 %)
7 g Z 1 (C) non-polymer(SO4) SULFATE ION 215G 216D(E) 217R 218W 279R (identity: 80.0 %/45.2 %)
8 h AA 1 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 224T(S) 225T(M) 226T(S) 229D(S) (identity: 0.0 %/45.2 %)
9 i BA 1 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 137K (identity: 100.0 %/45.2 %)
10 j CA 1 (C) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 41H 47E(T) 52P(I) 54Y 164H 165M(L) 187D 189Q(P) (identity: 50.0 %/45.2 %)
11 k DA 1 (D) non-polymer(SO4) SULFATE ION
12 l EA 1 (D) non-polymer(SO4) SULFATE ION
13 m FA 1 (D) non-polymer(SO4) SULFATE ION
14 n GA 1 (D) non-polymer(SO4) SULFATE ION
15 o HA 1 (D) non-polymer(SO4) SULFATE ION 6M 298R (identity: 100.0 %/45.2 %)
16 p IA 1 (D) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1lvo_C_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_C_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S  SS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeeebbbbbbbbbeeeeee-bebeeeeeebeeeebebbeeeeebeeeebeeeebbbbbebeeebeeebe:    
Contact         :bb b bbbbbb  b                          j     j    j j                                              
Contact         :     o                                                                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_C_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSS      S  B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbebebeeebebbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeebebb:    
Contact         :                     bbbbb    d     bbb b                      jj   e      c   c      j j   eee d   
Contact         :                                    i                                                               

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_C_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB     --SGGGHHHHHHHT  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeeeeebbeeeebeeeebbebbeeeebeebee--eeebeebbeeeebebebbbbbbee-beeebeeeebbeeeebbbebbbebbbeeb:    
Contact         :              gggg     hhh  h                                                bfb  bbb            obb
Contact         :                                                                              gf                    

queryA       301:SGV: 303
                : **:
1lvo_C_1     297:YGV: 299
SecStr          :T  :    
ExpBur          :eee:    
Contact         :bb                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123