#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1lvo assembly_id=2

Protein Model on 1lvo assembly_id=2 (TEMPLATE: 1lvo assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a C 1 (C) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU 1S 4R 6M 7A 8F(Q) 9P 10S 11G 14E 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 137K 138G 139S 140F 141L(I) 166E 172H 278G 280T 283G(S) 284S(Y) 285A(G) 290E 299Q 302G (identity: 73.3 %/44.9 %)
2 b A(queryA) D 1 (D) polymer(polypeptide(L)) [301 aa] Replicase, hydrolase domain :R1AB_CVPPU
3 c V 1 (C) non-polymer(SO4) SULFATE ION
4 d W 1 (C) non-polymer(SO4) SULFATE ION
5 e X 1 (C) non-polymer(SO4) SULFATE ION
6 f Y 1 (C) non-polymer(SO4) SULFATE ION
7 g Z 1 (C) non-polymer(SO4) SULFATE ION
8 h AA 1 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
9 i BA 1 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 1S 2G 214N (identity: 100.0 %/44.9 %)
10 j CA 1 (C) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
11 k DA 1 (D) non-polymer(SO4) SULFATE ION 131R 197D(N) (identity: 50.0 %/44.9 %)
12 l EA 1 (D) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/44.9 %)
13 m FA 1 (D) non-polymer(SO4) SULFATE ION 215G 216D(E) 217R 218W 279R (identity: 80.0 %/44.9 %)
14 n GA 1 (D) non-polymer(SO4) SULFATE ION 279R 280T (identity: 100.0 %/44.9 %)
15 o HA 1 (D) non-polymer(SO4) SULFATE ION 116A 124G(S) 141L(I) (identity: 33.3 %/44.9 %)
16 p IA 1 (D) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 41H 47E(T) 52P(I) 54Y 164H 165M(L) 187D 188R(Q) 189Q(P) (identity: 44.4 %/44.9 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:1lvo_D_1 identity=44.9%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_D_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbbeebbbbbbbbbeeeeee-bebeeebeeeeeeebebbeeeeebebeebeeeebbbbbebeeebeeebe:    
Contact         :ai a aaaaaa  a                          p     p    p p                                              
Contact         :i                                                                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_D_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbeeebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeebb:    
Contact         :               o     aaaaaa   k     aaaaa                      ppa  l  a              ppp   lll k   
Contact         :                       o                o                                                           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_D_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB     --GGGGHHHHHHHS  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebbeeeebeeeebbebbeeeebeebee--eeebeebbeeeebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbeeee:    
Contact         :             immmm                                                           ama  aaa    a        a 
Contact         :                                                                              nn                    

queryA       301:SGVTF: 305
                : **  :
1lvo_D_1     297:YGVNL: 301
SecStr          :H S  :    
ExpBur          :eeeee:    
Contact         : a                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123