#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1p9u assembly_id=2

Protein Model on 1p9u assembly_id=2 (TEMPLATE: 1p9u assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [300 aa] putative coronavirus nsp2 (3CL-PRO) :R1AB_CVPPU
2 b D 1 (D) polymer(polypeptide(L)) [301 aa] putative coronavirus nsp2 (3CL-PRO) :R1AB_CVPPU 1S 2G 4R 6M 7A 8F(Q) 9P 10S 11G 14E 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 128C(V) 137K 138G 139S 141L(I) 278G 280T 283G(S) 284S(Y) 285A(G) 299Q 300C(M) 301S(Y) 302G (identity: 63.3 %/45.2 %)
3 c Q 1 (C) non-polymer(SO4) SULFATE ION 239Y(F) 240E(T) 241P(E) (identity: 0.0 %/45.2 %)
4 d R 1 (C) non-polymer(SO4) SULFATE ION 131R 197D(N) (identity: 50.0 %/45.2 %)
5 e S 1 (C) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/45.2 %)
6 f T 1 (C) non-polymer(SO4) SULFATE ION 215G 216D(E) 217R 218W 279R (identity: 80.0 %/45.2 %)
7 g U 1 (C) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 41H 47E(T) 52P(I) 164H 165M(L) 187D 188R(Q) 189Q(P) (identity: 37.5 %/45.2 %)
8 h V 1 (D) non-polymer(SO4) SULFATE ION
9 i W 1 (D) non-polymer(SO4) SULFATE ION
10 j X 1 (D) non-polymer(SO4) SULFATE ION
11 k Y 1 (D) non-polymer(SO4) SULFATE ION
12 l Z 1 (D) non-polymer(SO4) SULFATE ION 6M 298R (identity: 100.0 %/45.2 %)
13 m AA 1 (D) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1p9u_C_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1p9u_C_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S SSS -  HHHHHHT  GGGEEEESSS EE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeeebbbbbbbbbeeeeee-bebeeeeeebeeeebebbbeeeebebeebeeeebbbbbebeeebeeebe:    
Contact         :bb b bbbbbb  b                          g     g    g                                                
Contact         :     l                                                                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1p9u_C_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSS      S  B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbebebeeebebbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeebb:    
Contact         :                     bbbbbbb  d     bbb b                      gg   e                 ggg   eee d   

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1p9u_C_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB     --SGGGHHHHHHHT  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebbeeeebeeeebbebbeeeebeebee--eeebeebbeeeebebebbbbbbee-beeebeeeebbeeeebbbebbbebbbebb:    
Contact         :              ffff                    ccc                                    bfb  bbb            lbb

queryA       301:SGV: 303
                : **:
1p9u_C_1     297:YGV: 299
SecStr          :T  :    
ExpBur          :eee:    
Contact         :bb                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123