#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1p9u assembly_id=2

Protein Model on 1p9u assembly_id=2 (TEMPLATE: 1p9u assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a C 1 (C) polymer(polypeptide(L)) [300 aa] putative coronavirus nsp2 (3CL-PRO) :R1AB_CVPPU 1S 4R 5K 6M 7A 8F(Q) 9P 10S 11G 14E 115L 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 137K 138G 139S 140F 141L(I) 166E 172H 278G 280T 283G(S) 284S(Y) 285A(G) 290E 299Q (identity: 74.2 %/44.9 %)
2 b A(queryA) D 1 (D) polymer(polypeptide(L)) [301 aa] putative coronavirus nsp2 (3CL-PRO) :R1AB_CVPPU
3 c Q 1 (C) non-polymer(SO4) SULFATE ION
4 d R 1 (C) non-polymer(SO4) SULFATE ION
5 e S 1 (C) non-polymer(SO4) SULFATE ION
6 f T 1 (C) non-polymer(SO4) SULFATE ION
7 g U 1 (C) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
8 h V 1 (D) non-polymer(SO4) SULFATE ION 131R 137K 197D(N) (identity: 66.7 %/44.9 %)
9 i W 1 (D) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/44.9 %)
10 j X 1 (D) non-polymer(SO4) SULFATE ION 215G 217R 218W 279R (identity: 100.0 %/44.9 %)
11 k Y 1 (D) non-polymer(SO4) SULFATE ION 279R 280T (identity: 100.0 %/44.9 %)
12 l Z 1 (D) non-polymer(SO4) SULFATE ION 116A 123S(G) 124G(S) (identity: 33.3 %/44.9 %)
13 m AA 1 (D) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 41H 47E(T) 164H 165M(L) 188R(Q) 189Q(P) (identity: 33.3 %/44.9 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:1p9u_D_1 identity=44.9%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1p9u_D_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebbeeeeeeebebbbeeeebebeeeeeeebbbbbebeeebeeebe:    
Contact         :a  aaaaaaaa  a                          m     m                                                     

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1p9u_D_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbeeebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeebb:    
Contact         :              al     aaaaaa   h     aaaaa                      mma  i  a               mm   iii h   
Contact         :                      ll            h                                                               

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1p9u_D_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB     --SGGGHHHHHHHT  HHHHHHHHHH-HTT  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebbeeeeeeeeebbebbeeeebeebee--eeebeebbeebebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbbeeb:    
Contact         :              j jj                                                           aja  aaa    a        a 
Contact         :                                                                              kk                    

queryA       301:SGVTF: 305
                : **  :
1p9u_D_1     297:YGVNL: 301
SecStr          :H S  :    
ExpBur          :eeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123