#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4wmd assembly_id=2

Protein Model on 4wmd assembly_id=2 (TEMPLATE: 4wmd assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [303 aa] ORF1a :W6A941_9BETC
2 b C 2 (C) polymer(polypeptide(L)) [303 aa] ORF1a :W6A941_9BETC 1S 2G 4R(V) 5K 6M 7A(S) 8F(H) 9P 10S 11G 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 283G 284S 285A(T) 286L(M) 298R(M) 299Q 300C(I) 302G (identity: 67.6 %/51.8 %)
3 c H 1 (C) non-polymer(1PE) PENTAETHYLENE GLYCOL 6M 7A(S) 8F(H) 113S 298R(M) 302G (identity: 50.0 %/51.8 %)
4 d H 2 (C) non-polymer(1PE) PENTAETHYLENE GLYCOL 118Y 123S(T) (identity: 50.0 %/51.8 %)
5 e I 1 (C) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 197D 198T(K) 199T(Y) 238N(Q) (identity: 25.0 %/51.8 %)
6 f I 2 (C) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
7 g J 1 (C) non-polymer(PGE) TRIETHYLENE GLYCOL 41H 140F 141L 142N(C) 144S 163H 164H(Q) 165M 166E 189Q (identity: 80.0 %/51.8 %)
8 h J 2 (C) non-polymer(PGE) TRIETHYLENE GLYCOL
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4wmd_C_1 identity=51.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4wmd_C_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TTTTTS  HHHHHHT  GGGEEEE  SSS  EE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbbbbbeeeebeebebeebeeebeeeebebebeeeeeeebebebeeeeebbbebebeeebee:    
Contact         :bb bbbbbbbb  b                          g                                                           
Contact         :     ccc                                                                                            

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *  *   **:
4wmd_C_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEE     TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :               c    d   bbbbb          bbbbbg g                  gggb  bb b                g       e
Contact         :                         d                gg                        g                               

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4wmd_C_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS      HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeebebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :ee              b                       e                                             bbbb          

queryA       297:VRQCSGV: 303
                :  *  **:
4wmd_C_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebeeee:    
Contact         : bbb b                                                                                              
Contact         : c   c                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123