#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4wme assembly_id=2

Protein Model on 4wme assembly_id=2 (TEMPLATE: 4wme assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [302 aa] MERS-CoV 3CL protease :W6A941_9BETC
2 b D 1 (D) polymer(polypeptide(L)) [306 aa] MERS-CoV 3CL protease :W6A941_9BETC 1S 2G 4R(V) 5K 6M 7A(S) 8F(H) 9P 10S 11G 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 215G 283G 284S 285A(T) 286L(M) 299Q 300C(I) 302G (identity: 70.6 %/51.7 %)
3 c M 1 (C) non-polymer(EDO) 1,2-ETHANEDIOL 5K 6M 7A(S) 125V(T) 126Y(F) 127Q(T) (identity: 33.3 %/51.7 %)
4 d N 1 (C) non-polymer(EDO) 1,2-ETHANEDIOL 218W 219F 221N(K) 266A(Y) 270E(Q) (identity: 40.0 %/51.7 %)
5 e O 1 (C) non-polymer(EDO) 1,2-ETHANEDIOL 134F(Y) 181F(M) 182Y 183G 184P(A) (identity: 40.0 %/51.7 %)
6 f P 1 (C) non-polymer(EDO) 1,2-ETHANEDIOL 103F 104V(T) 105R(T) 178E(D) (identity: 25.0 %/51.7 %)
7 g Q 1 (C) non-polymer(EDO) 1,2-ETHANEDIOL 8F(H) 111T(A) 112F 113S 127Q(T) 151N(T) (identity: 33.3 %/51.7 %)
8 h R 1 (C) non-polymer(EDO) 1,2-ETHANEDIOL 224T(R) 226T(S) 262L(E) (identity: 0.0 %/51.7 %)
9 i S 1 (D) non-polymer(EDO) 1,2-ETHANEDIOL
10 j T 1 (D) non-polymer(EDO) 1,2-ETHANEDIOL
11 k U 1 (D) non-polymer(EDO) 1,2-ETHANEDIOL
12 l V 1 (D) non-polymer(EDO) 1,2-ETHANEDIOL
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4wme_C_1 identity=51.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4wme_C_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS GGGTTS  HHHHHHH  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbbbbbeeeebeebebeebeeebeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :bb bbbbbbbb  b                                                                                      
Contact         :    cccg                                                                                            

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *  *   **:
4wme_C_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbeebeeeeebbbbbbbbebbeeebeeebbbbbbbebeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :     fff     ggg        bbbbbc      e  bbbbb         g              b  bb b     f  eeee             
Contact         :                           ccg                                                                      

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4wme_C_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHTTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHT-T  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeebebebebbbebbbebe-eebeeeebeebeebebebbbebb:    
Contact         :                bb  dd d  h h                                    h   d   d            bbbb          

queryA       297:VRQCSG: 302
                :  *  *:
4wme_C_1     297:NMQIMG: 302
SecStr          :HHHHH :    
ExpBur          :bebeee:    
Contact         :  bb b                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123