#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4wmf assembly_id=2

Protein Model on 4wmf assembly_id=2 (TEMPLATE: 4wmf assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] MERS-CoV 3CL protease :W6A941_9BETC
2 b B 1 (B) polymer(polypeptide(L)) [303 aa] MERS-CoV 3CL protease :W6A941_9BETC 1S 2G 4R(V) 5K 6M 7A(S) 8F(H) 9P 10S 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 283G 284S 285A(T) 286L(M) 298R(M) 299Q 300C(I) 302G (identity: 66.7 %/51.5 %)
3 c C 1 (C) polymer(polypeptide(L)) [289 aa] MERS-CoV 3CL protease :W6A941_9BETC 41H 49M(L) 140F 141L 142N(C) 143G 144S 145C(A) 163H 164H(Q) 165M 166E 167L 168P(A) 172H 186V(M) 187D 188R(K) 189Q 190T(V) 191A(H) 193A(V) (identity: 54.5 %/51.5 %)
4 d D 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 197D 198T(K) 199T(Y) 238N(Q) (identity: 25.0 %/51.5 %)
5 e E 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 101Y 102K(T) 103F (identity: 66.7 %/51.5 %)
6 f F 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 35V(T) 37Y(W) 88K (identity: 33.3 %/51.5 %)
7 g G 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
8 h H 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 6M 7A(S) 8F(H) 298R(M) 302G (identity: 40.0 %/51.5 %)
9 i I 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
10 j J 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
11 k K 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
12 l L 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 118Y 123S(T) (identity: 50.0 %/51.5 %)
13 m M 1 (C) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
14 n N 1 (C) non-polymer(PG4) TETRAETHYLENE GLYCOL
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4wmf_A_1 identity=51.5%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  **  ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4wmf_A_1       1:SGLVKMSHPSXDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          -  GGGEEEEEETTEEEEEEEETTEEEEEGGGGS GGGTTS  HHHHHHH  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeee-ebeebbbbbebeebebbbbbbeebbbbbbbbbbeeeebeebebeebeeebeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :bb bbbbbbb   b                    f f   c       c                                         f         
Contact         :     hhh                                                                                            

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *  *   **:
4wmf_A_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbeeeeebbbbbbbebebbeebebeeeeeeeeee:    
Contact         :   eee              l   bbbbb          bbbbbcccc                 cccbccbb b             cccccc c   d
Contact         :                         l                cc                        c     c                         

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4wmf_A_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS      HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeeeebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :dd              b                       d                                             bbbb          

queryA       297:VRQCSGV: 303
                :  *  **:
4wmf_A_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebeeee:    
Contact         : bbb b                                                                                              
Contact         : h   h                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123