#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4ylu assembly_id=2

Protein Model on 4ylu assembly_id=2 (TEMPLATE: 4ylu assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a C 1 (C) polymer(polypeptide(L)) [302 aa] ORF1a protein :A0A0A7E693_9BETC 1S 2G 4R(V) 5K 6M 7A(S) 8F(H) 9P 10S 11G 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 280T(Q) 283G 285A(T) 286L(M) 298R(M) 299Q 300C(I) 302G (identity: 64.7 %/52.2 %)
2 b A(queryA) D 1 (D) polymer(polypeptide(L)) [304 aa] ORF1a protein :A0A0A7E693_9BETC
3 c K 1 (C) non-polymer(R30) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}propanamide 1S (identity: 100.0 %/52.2 %)
4 d L 1 (C) non-polymer(ACT) ACETATE ION
5 e M 1 (D) non-polymer(R30) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}propanamide 25T(M) 41H 44C 45T(P) 46S(A) 49M(L) 54Y 140F 141L 142N(C) 144S 145C 163H 164H(Q) 165M 166E 187D 188R(K) 189Q (identity: 63.2 %/52.2 %)
6 f N 1 (D) non-polymer(ACT) ACETATE ION 197D 198T(K) (identity: 50.0 %/52.2 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:4ylu_D_1 identity=52.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4ylu_D_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGSSS  HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeeeebbbbbbeebbbbbebbbbeeeeeeebebeebbeebeeeebebebbeeeeeebebebeeeeebbbebebeeebee:    
Contact         :aa aaaaaaaa  a          e               e  eee  e    e                                              
Contact         :c                                                                                                   

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
4ylu_D_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :   EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbbebebeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                        aaaaa          aaaaae ee                 eeea  aa a              eee       f
Contact         :                                          ee                        e                               

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4ylu_D_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS   S  HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeebebbbbbbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :f               a                                                                  a  a aa          

queryA       297:VRQCSGV: 303
                :  *  **:
4ylu_D_1     297:NMQIMGV: 303
SecStr          :HHHHS  :    
ExpBur          :bebeeee:    
Contact         : aaa a                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123