#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5c5n assembly_id=2

Protein Model on 5c5n assembly_id=2 (TEMPLATE: 5c5n assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_CVHSA
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 172H 285A(T) 286L(I) 290E 298R 299Q 300C (identity: 93.5 %/95.8 %)
3 c B 1 (A) non-polymer(SLH) (2S)-3-(1H-imidazol-5-yl)-2-({[(3R,4aS,8aR)-2-(N-phenyl-beta-alanyl)decahydroisoquinolin-3-yl]methyl}amino)propanal 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 187D 188R(I) 189Q (identity: 93.3 %/95.8 %)
4 d B 2 (A) non-polymer(SLH) (2S)-3-(1H-imidazol-5-yl)-2-({[(3R,4aS,8aR)-2-(N-phenyl-beta-alanyl)decahydroisoquinolin-3-yl]methyl}amino)propanal
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5c5n_A_1 identity=95.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
5c5n_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  STTEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbb  b                          c       c                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ******* ************:
5c5n_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS  S       B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebeeb:    
Contact         :                     bbbbbbb        bbbbbcccc                 cccb     b              ccc           
Contact         :                                       cc                        c                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
5c5n_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHHHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbbeeeeebbeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebbbbbbbebbeeeb:    
Contact         :                                                                                    bb   b       bbb

queryA       301:SGVTFQ: 306
                :******:
5c5n_A_1     301:SGVTFQ: 306
SecStr          : SS   :    
ExpBur          :eeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123