#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1lvo assembly_id=3

Protein Model on 1lvo assembly_id=3 (TEMPLATE: 1lvo assembly_id:3 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a E 1 (E) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU 1S 2G 4R 5K 6M 7A 8F(Q) 9P 10S 11G 14E 115L 118Y 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 128C(V) 137K 138G 139S 141L(I) 170G 278G 283G(S) 284S(Y) 285A(G) 290E 299Q 300C(M) 302G (identity: 69.7 %/45.2 %)
2 b A(queryA) F 1 (F) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU
3 c JA 1 (E) non-polymer(SO4) SULFATE ION
4 d KA 1 (E) non-polymer(SO4) SULFATE ION
5 e LA 1 (E) non-polymer(SO4) SULFATE ION
6 f MA 1 (E) non-polymer(SO4) SULFATE ION
7 g NA 1 (E) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
8 h OA 1 (E) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 6M 298R (identity: 100.0 %/45.2 %)
9 i PA 1 (E) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
10 j QA 1 (F) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/45.2 %)
11 k RA 1 (F) non-polymer(SO4) SULFATE ION 217R 218W (identity: 100.0 %/45.2 %)
12 l SA 1 (F) non-polymer(SO4) SULFATE ION 62S(R) 63N(L) 64H (identity: 33.3 %/45.2 %)
13 m TA 1 (F) non-polymer(SO4) SULFATE ION 131R 137K 197D(N) (identity: 66.7 %/45.2 %)
14 n UA 1 (F) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 218W 278G 279R 280T (identity: 100.0 %/45.2 %)
15 o VA 1 (F) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 41H 47E(T) 52P(I) 164H 165M(L) 187D 188R(Q) 189Q(P) (identity: 37.5 %/45.2 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:1lvo_F_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_F_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeeebbbbbbbbbeeeeee-bebeebbeebeeeebbbbbeeeebebeebeeeebbbbbebeeebeeebe:    
Contact         :aa aaaaaaaa  a                          o     o    o         lll                                    
Contact         :     h                                                                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_F_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbeebbbeeebeebbebbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeeeb:    
Contact         :              a  a   aaaaaaa  m     aaa a                      oo   ja                ooo   jjj m   
Contact         :                                    m                                                               

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_F_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHTTT  TT       SHHHHHHHHTSSB     --SGGGHHHHHHHT  HHHHHHHHHT-TSS  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeebeebebeeebebeebbeebeeeebeebee--eeebeebbeeeeeebebbbbbbee-beeebeeeebbeeeebbbebbbebbbeee:    
Contact         :                kk                                                           ann  aaa    a       haa
Contact         :                 n                                                           n                      

queryA       301:SGV: 303
                : **:
1lvo_F_1     297:YGV: 299
SecStr          :S  :    
ExpBur          :eee:    
Contact         : a                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123