#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1lvo assembly_id=4

Protein Model on 1lvo assembly_id=4 (TEMPLATE: 1lvo assembly_id:4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU
2 b B 1 (B) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU 1S 2G 4R 6M 7A 8F(Q) 9P 10S 11G 14E 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 137K 138G 139S 140F 141L(I) 166E 172H 278G 280T 283G(S) 284S(Y) 285A(G) 290E 298R 299Q 300C(M) 302G (identity: 72.7 %/45.2 %)
3 c G 1 (A) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/45.2 %)
4 d H 1 (A) non-polymer(SO4) SULFATE ION 131R 137K 197D(N) (identity: 66.7 %/45.2 %)
5 e I 1 (A) non-polymer(SO4) SULFATE ION 215G 216D(E) 217R 218W (identity: 75.0 %/45.2 %)
6 f J 1 (A) non-polymer(SO4) SULFATE ION 104V(K) 105R(S) (identity: 0.0 %/45.2 %)
7 g K 1 (A) non-polymer(SO4) SULFATE ION 19Q(R) 21T(S) 26T(V) 67L(S) (identity: 0.0 %/45.2 %)
8 h L 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 6M 8F(Q) 111T(S) 112F 113S(N) 295D(E) (identity: 33.3 %/45.2 %)
9 i M 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 108P(A) 130M 131R 132P(S) 133N(Q) 134F(G) (identity: 33.3 %/45.2 %)
10 j N 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 123S(G) 124G(S) (identity: 0.0 %/45.2 %)
11 k O 1 (A) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 41H 47E(T) 164H 165M(L) 188R(Q) 189Q(P) (identity: 33.3 %/45.2 %)
12 l P 1 (B) non-polymer(SO4) SULFATE ION
13 m Q 1 (B) non-polymer(SO4) SULFATE ION
14 n R 1 (B) non-polymer(SO4) SULFATE ION
15 o S 1 (B) non-polymer(SO4) SULFATE ION
16 p T 1 (B) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
17 q U 1 (B) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
18 r E 2 (E) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU
19 s F 2 (F) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU
20 t JA 2 (E) non-polymer(SO4) SULFATE ION
21 u KA 2 (E) non-polymer(SO4) SULFATE ION
22 v LA 2 (E) non-polymer(SO4) SULFATE ION
23 w MA 2 (E) non-polymer(SO4) SULFATE ION
24 x NA 2 (E) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
25 y OA 2 (E) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
26 z PA 2 (E) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
27 1 QA 2 (F) non-polymer(SO4) SULFATE ION
28 2 RA 2 (F) non-polymer(SO4) SULFATE ION
29 3 SA 2 (F) non-polymer(SO4) SULFATE ION
30 4 TA 2 (F) non-polymer(SO4) SULFATE ION
31 5 UA 2 (F) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
32 6 VA 2 (F) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
33 7 C 3 (C) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU 48D(T) 49M(R) 50L(V) 184P(G) 185F(Y) 186V(E) 188R(Q) 189Q(P) 190T(S) 191A(M) 192Q (identity: 9.1 %/45.2 %)
34 8 D 3 (D) polymer(polypeptide(L)) [301 aa] Replicase, hydrolase domain :R1AB_CVPPU
35 9 V 3 (C) non-polymer(SO4) SULFATE ION
36 A W 3 (C) non-polymer(SO4) SULFATE ION
37 B X 3 (C) non-polymer(SO4) SULFATE ION
38 C Y 3 (C) non-polymer(SO4) SULFATE ION
39 D Z 3 (C) non-polymer(SO4) SULFATE ION
40 E AA 3 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
41 F BA 3 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
42 G CA 3 (C) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
43 H DA 3 (D) non-polymer(SO4) SULFATE ION
44 I EA 3 (D) non-polymer(SO4) SULFATE ION
45 J FA 3 (D) non-polymer(SO4) SULFATE ION
46 K GA 3 (D) non-polymer(SO4) SULFATE ION
47 L HA 3 (D) non-polymer(SO4) SULFATE ION
48 M IA 3 (D) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1lvo_A_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_A_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebbeeeeeeebebbeeeeebebeeeeeeebbbbbebeeebeeebe:    
Contact         :bb b bbbbbb  b    g g    g              k     k777                g                                 
Contact         :     h h                                                                                            

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_A_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSS         B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbebebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeebb:    
Contact         :   ff  i  hhh        bbbbbb  idiii  bbbbb                      kkb  c  b           777 kk777ccc d   
Contact         :                      jj      i     d                                                  77           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_A_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB     --SGGGHHHHHHH   HHHHHHHHHH-HTT  TT  BTTBSS    S HHHHHHHS:    
ExpBur          :bebbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeb--eeebeebbeebebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbeebb:    
Contact         :              eeee                                                           b b  bbb    b    h  bbb

queryA       301:SGV: 303
                : **:
1lvo_A_1     297:YGV: 299
SecStr          :S  :    
ExpBur          :eee:    
Contact         : b                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123