#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1lvo assembly_id=4

Protein Model on 1lvo assembly_id=4 (TEMPLATE: 1lvo assembly_id:4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description 8(query A)
1 a A 1 (A) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU
2 b B 1 (B) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU 215G 217R 218W 220L(V) 221N(T) 222R(N) (identity: 50.0 %/44.9 %)
3 c G 1 (A) non-polymer(SO4) SULFATE ION
4 d H 1 (A) non-polymer(SO4) SULFATE ION
5 e I 1 (A) non-polymer(SO4) SULFATE ION
6 f J 1 (A) non-polymer(SO4) SULFATE ION
7 g K 1 (A) non-polymer(SO4) SULFATE ION
8 h L 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
9 i M 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
10 j N 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
11 k O 1 (A) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
12 l P 1 (B) non-polymer(SO4) SULFATE ION
13 m Q 1 (B) non-polymer(SO4) SULFATE ION 279R (identity: 100.0 %/44.9 %)
14 n R 1 (B) non-polymer(SO4) SULFATE ION
15 o S 1 (B) non-polymer(SO4) SULFATE ION
16 p T 1 (B) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
17 q U 1 (B) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
18 r E 2 (E) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU 48D(T) 49M(R) 50L(V) 184P(G) 185F(Y) 186V(E) 188R(Q) 189Q(P) 190T(S) 191A(M) 192Q (identity: 9.1 %/44.9 %)
19 s F 2 (F) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU
20 t JA 2 (E) non-polymer(SO4) SULFATE ION
21 u KA 2 (E) non-polymer(SO4) SULFATE ION
22 v LA 2 (E) non-polymer(SO4) SULFATE ION
23 w MA 2 (E) non-polymer(SO4) SULFATE ION
24 x NA 2 (E) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
25 y OA 2 (E) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
26 z PA 2 (E) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 191A(M) (identity: 0.0 %/44.9 %)
27 1 QA 2 (F) non-polymer(SO4) SULFATE ION
28 2 RA 2 (F) non-polymer(SO4) SULFATE ION
29 3 SA 2 (F) non-polymer(SO4) SULFATE ION
30 4 TA 2 (F) non-polymer(SO4) SULFATE ION
31 5 UA 2 (F) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
32 6 VA 2 (F) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
33 7 C 3 (C) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU 1S 4R 6M 7A 8F(Q) 9P 10S 11G 14E 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 137K 138G 139S 140F 141L(I) 166E 172H 278G 280T 283G(S) 284S(Y) 285A(G) 290E 299Q 302G (identity: 73.3 %/44.9 %)
34 8 A(queryA) D 3 (D) polymer(polypeptide(L)) [301 aa] Replicase, hydrolase domain :R1AB_CVPPU
35 9 V 3 (C) non-polymer(SO4) SULFATE ION
36 A W 3 (C) non-polymer(SO4) SULFATE ION
37 B X 3 (C) non-polymer(SO4) SULFATE ION
38 C Y 3 (C) non-polymer(SO4) SULFATE ION
39 D Z 3 (C) non-polymer(SO4) SULFATE ION
40 E AA 3 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
41 F BA 3 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 1S 2G 214N (identity: 100.0 %/44.9 %)
42 G CA 3 (C) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
43 H DA 3 (D) non-polymer(SO4) SULFATE ION 131R 197D(N) (identity: 50.0 %/44.9 %)
44 I EA 3 (D) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/44.9 %)
45 J FA 3 (D) non-polymer(SO4) SULFATE ION 215G 216D(E) 217R 218W 279R (identity: 80.0 %/44.9 %)
46 K GA 3 (D) non-polymer(SO4) SULFATE ION 279R 280T (identity: 100.0 %/44.9 %)
47 L HA 3 (D) non-polymer(SO4) SULFATE ION 116A 124G(S) 141L(I) (identity: 33.3 %/44.9 %)
48 M IA 3 (D) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 41H 47E(T) 52P(I) 54Y 164H 165M(L) 187D 188R(Q) 189Q(P) (identity: 44.4 %/44.9 %)
ALIGNMENTS
MODEL[34] Protein A "queryA" TEMPLATE:1lvo_D_3 identity=44.9%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_D_3       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbbeebbbbbbbbbeeeeee-bebeeebeeeeeeebebbeeeeebebeebeeeebbbbbebeeebeeebe:    
Contact         :7F 7 777777  7                          M     Mrrr M M                                              
Contact         :F                                                                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_D_3     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbeeebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeebb:    
Contact         :               L     777777   H     77777                      MM7  I  7           rrrMrrrrrIII H   
Contact         :                       L                L                                              MM z         

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_D_3     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB     --GGGGHHHHHHHS  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebbeeeebeeeebbebbeeeebeebee--eeebeebbeeeebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbeeee:    
Contact         :             FbJbb bbb                                                       7m7  777    7        7 
Contact         :              J JJ                                                            JK                    
Contact         :                                                                              K                     

queryA       301:SGVTF: 305
                : **  :
1lvo_D_3     297:YGVNL: 301
SecStr          :H S  :    
ExpBur          :eeeee:    
Contact         : 7                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123