#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1lvo assembly_id=4

Protein Model on 1lvo assembly_id=4 (TEMPLATE: 1lvo assembly_id:4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description s(query A)
1 a A 1 (A) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU
2 b B 1 (B) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU
3 c G 1 (A) non-polymer(SO4) SULFATE ION
4 d H 1 (A) non-polymer(SO4) SULFATE ION
5 e I 1 (A) non-polymer(SO4) SULFATE ION
6 f J 1 (A) non-polymer(SO4) SULFATE ION
7 g K 1 (A) non-polymer(SO4) SULFATE ION
8 h L 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
9 i M 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
10 j N 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
11 k O 1 (A) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
12 l P 1 (B) non-polymer(SO4) SULFATE ION
13 m Q 1 (B) non-polymer(SO4) SULFATE ION
14 n R 1 (B) non-polymer(SO4) SULFATE ION
15 o S 1 (B) non-polymer(SO4) SULFATE ION
16 p T 1 (B) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
17 q U 1 (B) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
18 r E 2 (E) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU 1S 2G 4R 5K 6M 7A 8F(Q) 9P 10S 11G 14E 115L 118Y 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 128C(V) 137K 138G 139S 141L(I) 170G 278G 283G(S) 284S(Y) 285A(G) 290E 299Q 300C(M) 302G (identity: 69.7 %/45.2 %)
19 s A(queryA) F 2 (F) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU
20 t JA 2 (E) non-polymer(SO4) SULFATE ION
21 u KA 2 (E) non-polymer(SO4) SULFATE ION
22 v LA 2 (E) non-polymer(SO4) SULFATE ION
23 w MA 2 (E) non-polymer(SO4) SULFATE ION
24 x NA 2 (E) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
25 y OA 2 (E) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 6M 298R (identity: 100.0 %/45.2 %)
26 z PA 2 (E) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
27 1 QA 2 (F) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/45.2 %)
28 2 RA 2 (F) non-polymer(SO4) SULFATE ION 217R 218W (identity: 100.0 %/45.2 %)
29 3 SA 2 (F) non-polymer(SO4) SULFATE ION 62S(R) 63N(L) 64H (identity: 33.3 %/45.2 %)
30 4 TA 2 (F) non-polymer(SO4) SULFATE ION 131R 137K 197D(N) (identity: 66.7 %/45.2 %)
31 5 UA 2 (F) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 218W 278G 279R 280T (identity: 100.0 %/45.2 %)
32 6 VA 2 (F) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 41H 47E(T) 52P(I) 164H 165M(L) 187D 188R(Q) 189Q(P) (identity: 37.5 %/45.2 %)
33 7 C 3 (C) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU 217R 218W 279R (identity: 100.0 %/45.2 %)
34 8 D 3 (D) polymer(polypeptide(L)) [301 aa] Replicase, hydrolase domain :R1AB_CVPPU
35 9 V 3 (C) non-polymer(SO4) SULFATE ION
36 A W 3 (C) non-polymer(SO4) SULFATE ION
37 B X 3 (C) non-polymer(SO4) SULFATE ION
38 C Y 3 (C) non-polymer(SO4) SULFATE ION
39 D Z 3 (C) non-polymer(SO4) SULFATE ION
40 E AA 3 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
41 F BA 3 (C) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
42 G CA 3 (C) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
43 H DA 3 (D) non-polymer(SO4) SULFATE ION
44 I EA 3 (D) non-polymer(SO4) SULFATE ION
45 J FA 3 (D) non-polymer(SO4) SULFATE ION
46 K GA 3 (D) non-polymer(SO4) SULFATE ION
47 L HA 3 (D) non-polymer(SO4) SULFATE ION
48 M IA 3 (D) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
ALIGNMENTS
MODEL[19] Protein A "queryA" TEMPLATE:1lvo_F_2 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_F_2       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeeebbbbbbbbbeeeeee-bebeebbeebeeeebbbbbeeeebebeebeeeebbbbbebeeebeeebe:    
Contact         :rr rrrrrrrr  r                          6     6    6         333                                    
Contact         :     y                                                                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_F_2     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbeebbbeeebeebbebbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeeeb:    
Contact         :              r  r   rrrrrrr  4     rrr r                      66   1r                666   111 4   
Contact         :                                    4                                                               

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_F_2     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHTTT  TT       SHHHHHHHHTSSB     --SGGGHHHHHHHT  HHHHHHHHHT-TSS  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeebeebebeeebebeebbeebeeeebeebee--eeebeebbeeeeeebebbbbbbee-beeebeeeebbeeeebbbebbbebbbeee:    
Contact         :                22                                                           r55  rrr    r       yrr
Contact         :                75                                                           57                     
Contact         :                 7                                                                                  

queryA       301:SGV: 303
                : **:
1lvo_F_2     297:YGV: 299
SecStr          :S  :    
ExpBur          :eee:    
Contact         : r                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123