#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4f49 assembly_id=4

Protein Model on 4f49 assembly_id=4 (TEMPLATE: 4f49 assembly_id:4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1A_CVPPU
2 b H 1 (D) non-polymer(K36) (1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 41H 140F 141L(I) 142N(A) 143G 144S(T) 145C 163H 164H 165M(L) 166E 172H 187D 188R(Q) 189Q(P) (identity: 60.0 %/44.8 %)
3 c I 1 (D) non-polymer(PG4) TETRAETHYLENE GLYCOL 233V(W) 269K(V) 270E(R) 274N(K) (identity: 0.0 %/44.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4f49_D_1 identity=44.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *    * * *         * ***   ** ** :
4f49_D_1       8:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNXVFLGVVSARYKGVNLVLKVNQVNPNTPE: 106
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S SSS -  HHHHHHT  GGG EEE  - B  EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebbeeebeeebebebe-eebebeeeeeeebbbbbebeeebeeebe:    
Contact         :                                        b                                                           

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
4f49_D_1     107:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 206
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  S SS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbeeebbbebebeeebbbbbbbbeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeebb:    
Contact         :                                       bbbbbb                 bbbb     b              bbb           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
4f49_D_1     207:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 303
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB     --SGGGHHHHHHHT  HHHHHHHHHH-HTT  TT  BTTBSS   SS HHHHHHHH:    
ExpBur          :bebbbbbbbbbbebeeeebeeeeebeeeebbebbeeeebeebee--eeebeebbeeeeeebebbbbbbbe-beeebeeeebbeeeebbbebbbebbbeee:    
Contact         :                                c                                   cc   c                          

queryA       301:SGV: 303
                : **:
4f49_D_1     304:YGV: 306
SecStr          :H  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123