Protein Model on 1owe_A_1_E_1 (TEMPLATE: 1owe )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[3D template]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query F)
1 a FA 1 (A) polymer(polypeptide(L)) [245 aa] Urokinase-type plasminogen activator :UROK_HUMAN
2 b E 1 (A) non-polymer(675) 6-[(Z)-AMINO(IMINO)METHYL]-N-PHENYL-2-NAPHTHAMIDE 46H 94H 192D 193S 195Q 198S 216V 218W 219G 221G 222C 229G
FOCUSED TEMPLATE
MODEL[1] TEMPLATE:1owe_A_1
1owe_A_1       1:IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIAL: 100
SecStr          : BSSEE  GGGSTTEEEEEEE TTS EEEEEEEEEEETTEEEE GGGTTTS  GGGEEEEES  BTTS  TT EEEEEEEEEE TT EE SS EES  EE:    
ExpBur          :bbeeeebebeebbbbbbbbbeeeeeeeebbbbbbbbeebbbbbbbebbeeeeeeebbbbbbbbbebeeebeebeebebeebbebeebeeeeebeebbbbb:    
Contact         :                                             b                                               b      

1owe_A_1     101:LKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGG: 200
SecStr          :EEEE TTS      SS    B   TT    TT EEEEEES  SSTT  S  SB EEEEEEEE HHHHTSTTTTGGGS TTEEEEE TTS  B  TT TT :    
ExpBur          :bebebeeeeebeeeebbeebbebeeeeebeeebebbbbbbbbeeeeeeeebeebbbbebebbeeeebeeeebbeeebeeebbbbbbeebebbbbebbbbb:    
Contact         :                                                                                           bb b  b  

1owe_A_1     201:PLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT-------------------------------------------------------: 245
SecStr          :EEEEEETTEEEEEEEEEE SSSS TT  EEEEEGGGGHHHHHHH-:    
ExpBur          :bbbbebeeeebbbbbbbbeeebbeeeebbbbbbbbebbebbeee-:    
Contact         :               b bb bb      b                                                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123