Protein Model on 2r2w_A_1_C_1 (TEMPLATE: 2r2w )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[3D template]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query F)
1 a FA 1 (U) polymer(polypeptide(L)) [247 aa] Plasminogen activator, urokinase :Q5SWW9_HUMAN
2 b C 1 (U) non-polymer(4PG) 1-[4-(2-oxo-2-phenylethyl)phenyl]guanidine 46H 94H 192D 193S 194C 195Q 196G 198S 216V 217S 218W 219G 220R 221G 222C 227K 229G
FOCUSED TEMPLATE
MODEL[1] TEMPLATE:2r2w_A_1
2r2w_A_1       1:IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIAL: 100
SecStr          : BSSEE  GGGSTTEEEEEEE TTS EEEEEEEEEEETTEEEE GGGTTT   GGGEEEEES  BSSS  TT EEEEEEEEEE TT EE SS EES  EE:    
ExpBur          :bbeeeebebeebbbbbbbbbeeeeeeeebebbbbbbeeebbbbbbebbeeeeeeeebbbbbbbbebeeebeebeebbbeebbebeebeeeeebeebbbbb:    
Contact         :                                             b                                               b      

2r2w_A_1     101:LKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGG: 200
SecStr          :EEEE TTS      SS    B   TT    TT EEEEEES  SSTT SS  SB EEEEEEEE HHHHTSTTTTGGGS TTEEEEE TTS  B  TT TT :    
ExpBur          :bebebeeeeebeeeebbeebeebeeeebbeeeeebbbbbbbeeeeeeeeebeebbbbebebbebeebeeeebbeeebeeebbbbbbeebebbbbebbbbb:    
Contact         :                                                                                           bbbbb b  

2r2w_A_1     201:PLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE-----------------------------------------------------: 247
SecStr          :EEEEEETTEEEEEEEEEE SSSSBTTB EEEEEGGG HHHHHHHH -:    
ExpBur          :bbbbebeeeebbbbbbbbeeebeeeeebbbbbbbbbbbebbeeeee-:    
Contact         :               bbbbbbb    b b                                                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123