Protein Model on 1p9m_B_1_A_1 (TEMPLATE: 1p9m )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) B 1 (B) polymer(polypeptide(L)) [163 aa] Interleukin-6 :IL6_HUMAN
2 b A 1 (A) polymer(polypeptide(L)) [298 aa] Interleukin-6 receptor beta chain :IL6RB_HUMAN 47L 52R 55K 56Q 59Y 62D 138E 141R 142A 145M 152Q 153F (identity: 100.0 %/98.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1p9m_B_1 identity=98.2%
queryA        47:LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS: 146
                :****************************   *********************************************************************:
1p9m_B_1      21:LTSSERIDKQIRYILDGISALRKETCNKXXXCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS: 120
SecStr          :  TTHHHHTHHHHHHHHHHHHHHHHTT ---  S      S         GGGT SSTT  HHHHHHHHHHHHHHHHHHHHHHTTS STTHHHHHHHHHH:    
ExpBur          :eeeeeebeeebeebeebbebbeebbbee---eeeeeeeeeeeeeebbebeeebbbeeeeeeeeebbebbbbbbbebebbbebbbeebeebeeebebbbeb:    
Contact         :b    b  bb  b  b                                                                           b  bb  b 

queryA       147:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :******************************************************************:
1p9m_B_1     121:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 186
SecStr          :HHHHHHHHHHSSTTT S     TTHHHHHHHHHTSS HHHHHHHHHHHHHHHHHHHHHHHHHHH  :    
ExpBur          :beebbeebbeebeeeeeeeeeeeeeeeeeeeebeeeeeeebeebbbebbebbeebbeebbebbeee:    
Contact         :     bb                                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123