Protein Model on 2ahm_G_2_D_2 (TEMPLATE: 2ahm )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) G 2 (G) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
2 b D 2 (D) polymer(polypeptide(L)) [76 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 3950S 4002E 4004M 4005A 4008A 4009M 4011Q 4012M (identity: 100.0 %/97.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ahm_G_2 identity=97.4%
queryA      3943:AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDN:4042
                :************** *************************************************************************************:
2ahm_G_2       6:AIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDN: 105
SecStr          :  GGGSTTSHHHHHHHHHHHHHHHHHHTT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH  :    
ExpBur          :eeeeeeeebebeeebeebeeeeeebeeeeeeeebbeebeeebeebeeebeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeeeee:    
Contact         :       b                                                   b bb  bb bb                              

queryA      4043:DALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :******************************* *** ******** *************************** ******************:
2ahm_G_2     106:DALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRA: 196
SecStr          :HHHHHHHHHHHTT EESS    STT EEEEEE SHHHHHHHEETTEEE SSSEEEEEEEE TTS B  STT STTTGGGS SSEEEEEEE :    
ExpBur          :eeeeeeeebeeeebeeeeeebeeeebebebbbeebebbeebbeeeebebbebebebeebbbeeeeebeeeebeeeebeebeeebebbbeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123