Protein Model on 2ynb_A_1_D_1 (TEMPLATE: 2ynb )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-LIKE PROTEINASE :R1A_BCHK4
2 b D 1 (A) non-polymer(NI) NICKEL (II) ION 3405N(C) (identity: 0.0 %/51.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ynb_A_1 identity=51.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
2ynb_A_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TT  SS  HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeeeeeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
2ynb_A_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbeebebeeeebbbbbebebbeeebeeebbbbbbbeeeeeebebbbbbbbeeeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                                            b                                                       

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
2ynb_A_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HHHHH---HHHHHT  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHH:    
ExpBur          :eebbbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebebebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    

queryA      3560:VRQCSGVTFQ:3569
                :  *  **  *:
2ynb_A_1     297:NMQVMGVVMQ: 306
SecStr          :HHHH      :    
ExpBur          :beebeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123