Protein Model on 4ow0_A_1_G_1 (TEMPLATE: 4ow0 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (A) polymer(polypeptide(L)) [312 aa] papain-like protease :R1A_CVHSA
2 b G 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 1687E 1740N 1744C(A) 1802S 1803P(S) (identity: 60.0 %/82.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ow0_A_1 identity=82.4%
queryA      1566:RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLT:1665
                : ********** ***** ***************************  ****** *** ***** ******** * ***************** *** ***:
4ow0_A_1       4:KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLT: 103
SecStr          : EEEEEEESSSSS EEEEEESSS SHHHHSSEESSS  GGGS   SS TT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETTEE:    
ExpBur          :eebebebbbbeeeebeeebeeeebbeeebeebbeebeebeeeebeeebeeebbbbebeeeebeebbeebbeeeeeebbbebbebbeebeebebeebeebb:    

queryA      1666:SIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGV:1765
                :******** **   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** **:
4ow0_A_1     104:SIKWADNNUYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGV: 203
SecStr          :     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TT    HHHHHHHHHTTBS TT EEEEEEE SSS EEEEEEETH:    
ExpBur          :bbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbeeebeeebebeebbeebbebbebeebebbbeeebeeeeeeeeebeee:    
Contact         :                     b                                                    b   b                     

queryA      1766:EAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD:1865
                :***********   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** **:
4ow0_A_1     204:EAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD: 303
SecStr          :HHHEEES S HHHHHH EEEE SSSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEESEEEEEEEE:    
ExpBur          :ebbbbeebbbbeebbebbeeebeeeeebebbbbebebebbbbbbeeeeeebeeeebebbbbbeeeeeeeebbbbbeeeebbebebeeeeebeebebebbb:    
Contact         :                                    bb                                                              

queryA      1866:VFYKENSYTTTI:1877
                :***** ******:
4ow0_A_1     304:VFYKETSYTTTI: 315
SecStr          :EEEE SEEE   :    
ExpBur          :bbbebeebeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123