Protein Model on 1bk5 assembly_id=1 (TEMPLATE: 1bk5 assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [422 aa] KARYOPHERIN ALPHA :IMA1_YEAST
2 b B 1 (B) polymer(polypeptide(L)) [422 aa] KARYOPHERIN ALPHA :IMA1_YEAST 150G 151T 238R 239N(G) 240K 241N(K) 273W 315R 390D(E) 391F(Y) 392K 395K 430T(E) 431A(I) 433D 477Q 478N(Q) 479H(N) 480E 482E(D) 485Y 489L(Y) 493E (identity: 56.5 %/49.6 %)
3 c C 1 (A) non-polymer(CO) COBALT (II) ION
4 d D 1 (B) non-polymer(CO) COBALT (II) ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1bk5_A_1 identity=49.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
1bk5_A_1       4:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 103
SecStr          :HHHHHT S HHHHHHHHHHHHHHTT SS   HHHHHHTT HHHHHHTTSTTS HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHH:    
ExpBur          :bbeebebeeeeebeebbeebbebbeeeeeeebeebeeeebbebbbebbeeebeeebbbbbbebbbbbbeeeeebbeebbebebbebbbebbeebeeebee:    
Contact         :                                                                     bb                             

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
1bk5_A_1     104:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 198
SecStr          :HHHHHHHHHHHH HHHHHHHHHTT HHHHHHGG-----GS  HHHHHHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHTT:    
ExpBur          :bbbebbbbbbeeeeebbeebbeeebbebbbebb-----eeeeeebbeebbebbbbbbeeeeeebeeebbeebbebbbebbeeeeeebbbbbbebbbbbbe:    
Contact         :                                                         bbbb                               b       

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
1bk5_A_1     199:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 298
SecStr          :S HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHHTS HHHHHHHHHTT HH:    
ExpBur          :beeebbeebbeeebbeebbebbebeeeebbebbbebbbbbbeeeeebbeebbebebbebbeebbebeeeebeebbbebbbebbeeebebbeebbeeebbe:    
Contact         :                                  b                                                                 

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
1bk5_A_1     299:PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKI: 398
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHHHTTTT HHHHHHHHHTT HHHHHHHHHH  HHHHHHHHHHHHHHHHHHHHHHHHS  SS HHHHHHHHHTHHHHH:    
ExpBur          :bbbebbeebeeebbebbbebbbbbbebbeeeeebbeebbeeebbebbbebbeebeeebbebbbebbbebbebbeebeeeeeeeebebbeebeebebeebb:    
Contact         :         bbb  b                                    bb b                                             

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :   *  **   *      ** **:
1bk5_A_1     399:FNCQQNENDKIYEKAYKIIETYF: 421
SecStr          :HHGGG S HHHHHHHHHHHHHH :    
ExpBur          :eebbebeeeebeebbeebbeebb:    
Contact         :   bbbb b  b   b   b                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123