Protein Model on 2jdq_B_1_A_1 (TEMPLATE: 2jdq )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [426 aa] IMPORTIN ALPHA-1 SUBUNIT :IMA1_HUMAN
2 b A 1 (A) polymer(polypeptide(L)) [424 aa] IMPORTIN ALPHA-1 SUBUNIT :IMA1_HUMAN 345T(S) 380P 387S(Q) 414V(K) 415Y 417V 418H(E) 419C(L) 420G 423E(K) 462I 463M(L) 466E 467C(A) 470L (identity: 46.7 %/50.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2jdq_B_1 identity=50.7%
queryA        80:DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI: 178
                :*    * *   * ** ***  ***** *  ****  *   *    ** ** *      ****** ******* * **  *   ** * ** ** *     :
2jdq_B_1      24:DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDV: 123
SecStr          :HHHHHHSSS HHHHHHHHHHHHHHTTSSS   HHHHHTSTT HHHHHHHTT TT HHHHHHHHHHHHHHHSS HHHHHHHHHTTHHHHHHHHTT S HHH:    
ExpBur          :ebeeebebeeeeebbebbeebeeebeeeeeeebeebbebeebbebbbebbeeeeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbebeeeeb:    

queryA       179:SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL: 278
                : *************    ** *       *** *              **  * ****** * * *    *   *  *  **   *  **** *** ***:
2jdq_B_1     124:QEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYL: 219
SecStr          :HHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTTSS   HHHH----HHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT   HHHHHHHHHHHHHH:    
ExpBur          :bbbbbebbbbbbeeebebbeebbeeebbeebbebbeeeeeeebb----ebbbebbbbbbeeeeeebebeebeebbebbbebbeeebeebbbbbbebbbeb:    

queryA       279:TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL: 378
                : ****  *  *   **   ** **       * ***** ****** * ****     **     **  **  * *** ** ******   *** *     :
2jdq_B_1     220:SDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI: 319
SecStr          :TSS HHHHHHHHHTTTHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTT :    
ExpBur          :beeeeebbeebbebebbeebbebbeeeeeebbbbbbebbbbbbebeeebbeebbebebbebbeebbebeeeebbebbbebbbebbebeeebbeebbebeb:    
Contact         :                                                                  b                                 

queryA       379:VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : * * * *  * * * *** ** ** ****  *** ***  * * **  ***  * **  * *    **    *         *      ***  *****:
2jdq_B_1     320:FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKI: 419
SecStr          :HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHHTTSS HHHHHHHHHHHHHHHHHHHHHHHHTSS   HHHHHHHHHH HHHH:    
ExpBur          :beebbebbeebeeebbebbbebbbbbbeebbeebbeebbeeebbebbbebbebeeeebeebbeebbebbeebbeeebeeeeeeebebeeebeebbeeeeb:    
Contact         : b      b                          bb bbbb  b                                      b b  bb  bb  b   

queryA       474:EALQNHENESVYKASLSLIEKYFSVEEE: 501
                :* ** ***   *     *** **  * *:
2jdq_B_1     420:EFLQSHENQEIYQKAFDLIEHYFGTEDE: 447
SecStr          :HHHH HHHHHHHHHHHHHHHHHT     :    
ExpBur          :eeeeeeeeeeeeeeeeeeeeeeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123