#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4yog assembly_id=1

Protein Model on 4yog assembly_id=1 (TEMPLATE: 4yog assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4 3264S 3265G 3267R(V) 3268K 3269M 3270A(S) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3429E 3432T(N) 3433G 3435H 3477N 3546G 3548A(S) 3549L(T) 3562Q 3564S(M) (identity: 73.3 %/51.0 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4
3 c C 1 (A) non-polymer(ACT) ACETATE ION 3275K(A) (identity: 0.0 %/51.0 %)
4 d D 1 (A) non-polymer(ACT) ACETATE ION
5 e E 1 (A) non-polymer(ACT) ACETATE ION
6 f F 1 (A) non-polymer(ACT) ACETATE ION
7 g G 1 (A) non-polymer(4F5) N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)-N-[(1R)-2-(tert-butylamino)-2-oxo-1-(thiophen-3-yl)ethyl]acetamide 3264S (identity: 100.0 %/51.0 %)
8 h H 1 (B) non-polymer(ACT) ACETATE ION 3364Y (identity: 100.0 %/51.0 %)
9 i I 1 (B) non-polymer(ACT) ACETATE ION 3274G 3278G(N) (identity: 50.0 %/51.0 %)
10 j J 1 (B) non-polymer(ACT) ACETATE ION 3394R 3460D 3461T(K) 3462T(Y) (identity: 50.0 %/51.0 %)
11 k K 1 (B) non-polymer(4F5) N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)-N-[(1R)-2-(tert-butylamino)-2-oxo-1-(thiophen-3-yl)ethyl]acetamide 3288T(M) 3304H 3309S(A) 3312M(L) 3403F 3404L 3405N(C) 3408C 3426H 3428M 3429E 3450D 3451R(K) 3452Q (identity: 64.3 %/51.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:4yog_B_1 identity=51.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yog_B_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  SGGGSS  HHHHHHH  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbebeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeeeeebebeeeeebebbbebebeeebee:    
Contact         :aa aaaa aaac ai         k               k    k  k                                                   
Contact         :g         i                                                                                         

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yog_B_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     GGGTT EEEEESSS EEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbeebeeeeeebbbbbebbbbeeebeebbbbbbbbeeeeeebbbbbbbbbeeeeebbbbbbbebebbeebebeeeeeeeeee:    
Contact         :   h                    aaaaa    j     aaaaak  k                 k ka  aa a              kkk       j
Contact         :                                          kk                        k                               

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yog_B_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHTTT  TT  S    HHHHHHHHTTTTB      HHHHH---HHHHH   HHHHHHHHHH-HHH  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbbeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebbbebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         :jj              a                                                                     a aa          

queryA      3560:VRQCSGVTFQ:3569
                :  *  **  *:
4yog_B_1     297:NMQVMGVVMQ: 306
SecStr          :HHTTTT    :    
ExpBur          :bebbeeeeee:    
Contact         :  a a                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123