#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5wkj assembly_id=1

Protein Model on 5wkj assembly_id=1 (TEMPLATE: 5wkj assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [302 aa] Orf1a protein :A0A1L2E0X0_9BETC 3263Q(H) 3265G 3267R(V) 3268K 3269M 3270A(S) 3271F(H) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V(T) 3389Y(F) 3400K 3401G 3402S 3404L 3432T(N) 3433G 3434V(T) 3546G 3547S 3548A(T) 3549L(M) 3561R(M) 3562Q 3565G (identity: 60.0 %/52.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [302 aa] Orf1a protein :A0A1L2E0X0_9BETC
3 c B 1 (A) non-polymer(CA) CALCIUM ION
4 d B 2 (A) non-polymer(CA) CALCIUM ION
5 e C 1 (A) non-polymer(CA) CALCIUM ION
6 f C 2 (A) non-polymer(CA) CALCIUM ION 3361T (identity: 100.0 %/52.0 %)
7 g D 1 (A) non-polymer(B1S) (1R,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid
8 h D 2 (A) non-polymer(B1S) (1R,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 3304H 3312M(L) 3403F 3404L 3405N(C) 3407S 3408C 3426H 3427H(Q) 3428M 3429E 3435H 3450D 3451R(K) 3452Q (identity: 73.3 %/52.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5wkj_A_2 identity=52.0%
queryA      3263:QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANP:3359
                : **  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** ***:
5wkj_A_2       7:HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANP: 106
SecStr          :           HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TTS SS  HHHHHHH  GGGEEEE   --- EE EEEEEEETTEEEEEESS  T:    
ExpBur          :ebebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbebbbeeeeeeebebeebeeebeeeebebeeee---eebebebeeeeebbbebebeeebe:    
Contact         :a a aaaaaaaa  a                          h       h                                                  

queryA      3360:KTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGT:3459
                : ** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   *:
5wkj_A_2     107:STPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLT: 206
SecStr          :T  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS      :    
ExpBur          :eebeeeeeebeebeebbbbbbbebbeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeee:    
Contact         : f                       aaaaa          aaahah hh                 hhhh  aaah              hhh       
Contact         :                                            h                                                       

queryA      3460:DTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD:3558
                :*    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* *:
5wkj_A_2     207:DKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED: 302
SecStr          :  B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS   SS HHH:    
ExpBur          :eeebbebbbbbbbbbbeeeeeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeeeebbbebbbebbbebe-eebeeeebeebeebebbbbbeb:    
Contact         :                                                                                       aaaa         

queryA      3559:VVRQCSGV:3566
                :*  *  **:
5wkj_A_2     303:VNMQIMGV: 310
SecStr          :HHHHHH  :    
ExpBur          :bbeeeeee:    
Contact         :  aa  a                                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123