#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2z9k assembly_id=1

Protein Model on 2z9k assembly_id=1 (TEMPLATE: 2z9k assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [305 aa] 3C-like proteinase :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_CVHSA 3264S 3265G 3267R 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3378L 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3401G 3402S 3403F 3404L 3429E 3433G 3435H 3548A(T) 3549L(I) 3553E 3562Q 3566V 3567T 3568F (identity: 93.9 %/96.1 %)
3 c C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3403F 3404L 3405N 3407S 3408C 3426H 3428M 3429E 3435H (identity: 100.0 %/96.1 %)
4 d D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3269M 3270A 3271F 3390Q 3558D 3561R (identity: 100.0 %/96.1 %)
5 e E 1 (A) non-polymer(DOZ) (dimethylamino)(hydroxy)zinc' 3288T 3290L 3304H 3408C 3427H (identity: 100.0 %/96.1 %)
6 f F 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE
7 g G 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE 3386S (identity: 100.0 %/96.1 %)
8 h H 1 (B) non-polymer(DOZ) (dimethylamino)(hydroxy)zinc'
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2z9k_A_1 identity=96.1%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
2z9k_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TGGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeebbbbbbbbbbeeeebeeeebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bb b bbbbbb  b          e e             e                                                           
Contact         :     ddd                                                                                            

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
2z9k_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SS SS       B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :              b      bbbbbbb        bbbbbc cc                 cecb   b b                            
Contact         :                      g   d            cc   e                    c     c                            

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
2z9k_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebeebeebebbbbbebbebee:    
Contact         :                                                                                    bb   b    d  db 

queryA      3564:SGVTF:3568
                :*****:
2z9k_A_1     301:SGVTF: 305
SecStr          :TT   :    
ExpBur          :eeeee:    
Contact         :  bbb                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123