#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3snd assembly_id=1

Protein Model on 3snd assembly_id=1 (TEMPLATE: 3snd assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA 3264S 3265G 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3378L 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3401G 3402S 3403F 3404L 3429E 3433G 3435H 3548A(T) 3549L(I) 3553E 3562Q 3563C 3564S 3565G 3566V 3567T 3568F (identity: 94.6 %/96.1 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA
3 c C 1 (C) polymer(polypeptide(L)) [2 aa] Peptide aldehyde inhibitor Ac-ESTLQ-H
4 d D 1 (D) polymer(polypeptide(L)) [2 aa] Peptide aldehyde inhibitor Ac-ESTLQ-H 3304H 3312M 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3435H 3450D (identity: 100.0 %/96.1 %)
5 e E 1 (A) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:3snd_B_1 identity=96.1%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
3snd_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS SSTTSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeebbeebeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aa aaaaaaaa  a                          d       d                                                   

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
3snd_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :              a      aaaaaaa        aaaaadddd                 ddda   a a              d             
Contact         :                                       dd                        d     d                            

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
3snd_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbebeebebbbbbebbeeee:    
Contact         :                                                                                    aa   a        aa

queryA      3564:SGVTFQ:3569
                :******:
3snd_B_1     301:SGVTFQ: 306
SecStr          :HT    :    
ExpBur          :eeeeee:    
Contact         :aaaaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123