#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4ylu assembly_id=1

Protein Model on 4ylu assembly_id=1 (TEMPLATE: 4ylu assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] ORF1a protein :A0A0A7E693_9BETC
2 b B 1 (B) polymer(polypeptide(L)) [302 aa] ORF1a protein :A0A0A7E693_9BETC 3264S 3265G 3267R(V) 3268K 3269M 3270A(S) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V(T) 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3429E 3432T(N) 3433G 3435H 3477N 3546G 3547S 3548A(T) 3549L(M) 3562Q 3563C(I) 3565G (identity: 71.9 %/52.2 %)
3 c E 1 (A) non-polymer(R30) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}propanamide 3288T(M) 3304H 3312M(L) 3317Y 3403F 3404L 3405N(C) 3408C 3426H 3427H(Q) 3428M 3429E 3450D 3451R(K) 3452Q (identity: 66.7 %/52.2 %)
4 d F 1 (A) non-polymer(ACT) ACETATE ION 3366F 3367V(T) 3368R(T) 3439D(A) 3441E(D) (identity: 20.0 %/52.2 %)
5 e G 1 (A) non-polymer(ACT) ACETATE ION 3460D 3462T(Y) (identity: 50.0 %/52.2 %)
6 f H 1 (B) non-polymer(R30) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}propanamide 3264S (identity: 100.0 %/52.2 %)
7 g I 1 (B) non-polymer(ACT) ACETATE ION
8 h J 1 (B) non-polymer(ACT) ACETATE ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ylu_A_1 identity=52.2%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4ylu_A_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGTTS  HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeeeebbbbbbeeebbbbebbbbeeeeeeebebeebeeebeeeebebebbeeeeeebebebeeeeebbbebebeeebee:    
Contact         :bb bbbb bbb  b          c               c       c    c                                              
Contact         :f                                                                                                   

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
4ylu_A_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  EEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbbebebeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :     ddd                bbbbb          bbbbbc  c                 cccb  bb b   d d        ccc       e
Contact         :                                          cc                        c                               

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4ylu_A_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHT-T  TT  BTTBSS   S  HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbebbeeeebbebeeeebbee---bbeebebbbbbbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         : e              b                                                                     bbbb          

queryA      3560:VRQCSGV:3566
                :  *  **:
4ylu_A_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebeeee:    
Contact         :  bb b                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123