#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wuu_D_1_P_1

Protein Model on 6wuu_D_1_P_1 (TEMPLATE: 6wuu )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:4]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [318 aa] papain-like protease :R1AB_SARS2
2 b P 1 (D) non-polymer(MG) MAGNESIUM ION 1582Q 1624D (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wuu_D_1 identity=99.7%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :****************************************************************************************************:
6wuu_D_1       3:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG: 102
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHTSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   THHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebebeebbeeebeebbbeeeebbeeebeeebeeeebebeeeeeebeebbeebbeeeeeebbebbbebbeebeebebeebee:    
Contact         :                  b                                         b                                       

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :****************************************************************************************************:
6wuu_D_1     103:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK: 202
SecStr          :EE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbebbbbbbbbbebeeeeeeebeebbeebbeebebeebebbbbeebeeeeeeeeebe:    

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :****************************************************************************************************:
6wuu_D_1     203:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI: 302
SecStr          :GGGGTEEES S HHHHHH EEEE SSSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEES EEEEE:    
ExpBur          :eeebbbbeebbebeebbebbeeeeeeeeebeebbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebbb:    

queryA      1864:TDVFYKENSYTTTIKPV:1880
                :**************** :
6wuu_D_1     303:TDVFYKENSYTTTIKPL: 319
SecStr          :EEEEEE S EE      :    
ExpBur          :bbbbbebeebebeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123