Protein Model on 1bk5_B_1_D_1 (TEMPLATE: 1bk5 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [422 aa] KARYOPHERIN ALPHA :IMA1_YEAST
2 b D 1 (B) non-polymer(CO) COBALT (II) ION 150G 192D (identity: 100.0 %/49.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1bk5_B_1 identity=49.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
1bk5_B_1       4:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 103
SecStr          :HHHHHT S HHHHHHHHHHHHHHTT SS   HHHHHHTT HHHHHHTTSTTS HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHH  HHHHH:    
ExpBur          :bbebbebeeeeebeebbeebbebbeeeeeeebeebeeeebbebbbebbeeeeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbeebeeebeb:    
Contact         :                                                                     b                              

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
1bk5_B_1     104:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 198
SecStr          :HHHHHHHHHHTT HHHHHHHHHTT HHHHHHGG-----GS  HHHHHHHHHHHHHHH  STT   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHTS:    
ExpBur          :bbbebbbbbbeeeeebbeebbeeebbebbbebb-----eeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbeeeeeebbbbbbebbbbbbe:    
Contact         :           b                                                                                        

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
1bk5_B_1     199:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 298
SecStr          :S HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbebbbeeebbebbbebbebeeeebbebbbebbbbbbeeeeebbeebbebebbebbeebbebeeeebeebbbebbbebbeeebebbebbbebebbe:    

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
1bk5_B_1     299:PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKI: 398
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHHHTTTT HHHHHHHHHTT HHHHHHHHHH  HHHHHHHHHHHHHHHHHHHHHHHSSS SS HHHHHHHHTTHHHHH:    
ExpBur          :ebbebbeebeeebbebbbebbbbbbebbeeeeebbeebbeeebbebbbebbeebeeebbbbbbebbbbbbebbbeeeeeeeeeebebbeebeebebeebb:    

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :   *  **   *      ** **:
1bk5_B_1     399:FNCQQNENDKIYEKAYKIIETYF: 421
SecStr          :HHGGG S HHHHHHHHHHHHHH :    
ExpBur          :eebbebeeeebeeebeebbeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123