Protein Model on 1ee5_A_1_B_1 (TEMPLATE: 1ee5 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [421 aa] KARYOPHERIN ALPHA :IMA1_YEAST
2 b B 1 (B) polymer(polypeptide(L)) [19 aa] NUCLEOPLASMIN :NUPL_XENLA 108K(H) 110P 142W 146N 148A 149S 150G 151T 181Q 184W 188N 191G 192D 231W 235N 238R 240K 266E 273W 277Y 311T 315R 321V 322T 323G 324T(N) 328T 350N 354E 357W 360S 361N 364A 396E 399W 403N (identity: 94.4 %/49.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1ee5_A_1 identity=49.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
1ee5_A_1       6:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 105
SecStr          :HHHHHSSS HHHHHHHHHHHHHHHS SS   HHHHHHTT HHHHHGGGSTTS HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHH:    
ExpBur          :eeeebeeeeeebbeebbebbbeebeeeeeeebeebeeeebbebbbebbeeebeeebbbbbbebbbebbeeeeebbeebbeeebbebbbebbeebeeebee:    
Contact         :                           b b                               b   b bbbb                             

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
1ee5_A_1     106:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 200
SecStr          :HHHHHHHHHHTT HHHHHHHHHTT HHHHHHGG-----GS  HHHHHHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHTT:    
ExpBur          :bbbebbbbbbeeeeebbbebbebebbebbbebb-----eeebeebbebbbebbbbbbeeeeeebeeeebeebbeebbebbeeeeeebbbbbbebbbebbe:    
Contact         :b  b   b  bb                                      b   b  b b                         b      b   b   

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
1ee5_A_1     201:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 300
SecStr          :S HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHTTTTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbeebbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbeebbebebbebbeebbebeeeebbebbbbbbbebbeeeeebbeebbebebbe:    
Contact         :                              b   b     bbbb   b                     b   b  b  bb  b                

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
1ee5_A_1     301:PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKI: 400
SecStr          :HHHHHHHSS HHHHHHHHHHHHHHHGGGGT THHHHHHHHTT HHHHHTTTTSS HHHHHHHHHHHHHHHHHHHHHHHHTT SS HHHHHHHHTTHHHHH:    
ExpBur          :ebbbbbeeeeeebeebbbebbbebbebbeeeeebbeebbeeebbebbbebbebeeeebbbbbbebbbebbebbeebeeeeeeeebebbeebeebebeebb:    
Contact         :               b  b   b                                                                             

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :   *  **   *      ** **:
1ee5_A_1     401:FNCQQNENDKIYEKAYKIIETYF: 423
SecStr          :HHGGG S HHHHHHHHHHHHHH :    
ExpBur          :eebeeeeeeebbebbeebbeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123