Protein Model on 1ejl_C_1_A_1 (TEMPLATE: 1ejl )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (I) polymer(polypeptide(L)) [426 aa] IMPORTIN ALPHA :IMA2_MOUSE
2 b A 1 (A) polymer(polypeptide(L)) [7 aa] SV40 LARGE T ANTIGEN NLS PEPTIDE :TALA_SV40 240K 280D 281G 282P 283N 286I 315R 321V 322T 323G 325D 328T 353K 354E 357W 360S 361N 363T 364A 396E 399W 403N 406S 407G (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1ejl_C_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
1ejl_C_1       3:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 102
SecStr          :  TT  HHHHHHHHTSS HHHHHHHHHHHHHHHHSSS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbebbbebbbbbbeeeeebbebbbeeebbeebbebb:    

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
1ejl_C_1     103:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 202
SecStr          :T S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHS   TT   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbbb:    
Contact         :                                                                    b                               

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
1ejl_C_1     203:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 302
SecStr          :HHHHHHHTSS HHHHHHHHTTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHHTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbbbbbebbebeeebbe:    
Contact         :        bbbb  b                            b     bbb b  b                        bb  b  bb bb       

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
1ejl_C_1     303:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 402
SecStr          :HHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHTTSHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbbbbbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeebeebbeebeeeebbe:    
Contact         :                        b  b   b  bb                                                                

queryA       472:KIEALQNHENESVYKASLSLIEKYFS: 497
                :****** *********** *******:
1ejl_C_1     403:KIEALQRHENESVYKASLNLIEKYFS: 428
SecStr          :HHTTGGGSSSSHHHHHHHHHHHHH  :    
ExpBur          :ebeebbeeebeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123