Protein Model on 1ejy_B_1_A_1 (TEMPLATE: 1ejy )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (I) polymer(polypeptide(L)) [426 aa] IMPORTIN ALPHA :IMA2_MOUSE
2 b A 1 (N) polymer(polypeptide(L)) [16 aa] NUCLEOPLASMIN NLS PEPTIDE :NUPL_XENLA 104L 105S 106R 110P 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 273W 311T 315R 322T 350N 357W 360S 361N 364A 396E 399W (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1ejy_B_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
1ejy_B_1       3:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 102
SecStr          :  SS  HHHHHHHHHSS HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbebbbebb:    
Contact         :                                bbb   b                               b   b bbbbb  b                

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
1ejy_B_1     103:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 202
SecStr          :T S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbbb:    
Contact         :         b  b   b  bb                                   b  b   b  b                                 

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
1ejy_B_1     203:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 302
SecStr          :HHHHHHHTSSSHHHHHHHHTTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHHTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbeebeebbebeeeebbebbbebbbebbebeeebbe:    
Contact         : b                                     b   b      b                           b      b  bb  b       

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
1ejy_B_1     303:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 402
SecStr          :HHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbeeeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebbe:    
Contact         :                        b  b                                                                        

queryA       472:KIEALQNHENESVYKASLSLIEKYFS: 497
                :****** *********** *******:
1ejy_B_1     403:KIEALQRHENESVYKASLNLIEKYFS: 428
SecStr          :HHHHHTT SSHHHHHHHHHHHHHH  :    
ExpBur          :ebeebbeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123