Protein Model on 1g3j_C_1_D_1 (TEMPLATE: 1g3j )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [439 aa] BETA-CATENIN ARMADILLO REPEAT REGION :CTNB1_HUMAN
2 b D 1 (D) polymer(polypeptide(L)) [34 aa] TCF3-CBD (CATENIN BINDING DOMAIN) :P70062_XENLA 132D(N) 134S(K) 135P(F) 138F(I) 141A(D) 149S(Y) 150G 155T(K) 179S(Y) 191G(K) 192D(V) 195V 234S(R) 235N 241N(D) 244P(T) 273W(G) 276S 277Y(N) 279T 280D(C) 281G(N) 286I(K) 318G(R) 319N(H) 322T(S) 323G(R) 361N(K) 365G 368D(R) 369Q(N) 372Q(L) 412Q(E) (identity: 18.2 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1g3j_C_1 identity=27.4%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1g3j_C_1     144:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 239
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbebbbeebebeeeebbbebbe-bbebbbeeeeebbeebeeeebbebbbebbee---beeebbbbbbbbbbebbbebeebbeebbebbbbebbbebbe:    
Contact         :              b bb  b  b       bb    b                       b           bb  b                      

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1g3j_C_1     240:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 331
SecStr          : S HH-----HHHHHHHHHHHH---GGG TT S  HHHHHHHHHHTT S HHHHHHHHHHHHHHTTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebbebeebeebbebbbebbeeeeeebbbbbbbbbbebbeebeebbeebbeeebbebbbebbeebeeebebbeb:    
Contact         :                   bb     b  b                            b  bb bbb    b                            

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV: 401
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
1g3j_C_1     332:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGX: 423
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHHHHHHH -:    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------bebebbebbbbbbebbbebeebbeebeeeebbebbbebbebbbeebebbeeee-:    
Contact         :     bb  bb                                         b   b  bb  b                                    

queryA       402:T--NYTSGGTVEQIV: 414
                :       *   * **:
1g3j_C_1     424:XXQQFVEGVRMEEIV: 438
SecStr          :--   BTTB HHHHH:    
ExpBur          :--eeeeeebebeebb:    
Contact         :            b                                                                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123