Protein Model on 1i7w_A_1_C_1 (TEMPLATE: 1i7w )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [500 aa] BETA-CATENIN :CTNB1_MOUSE
2 b C 1 (C) polymer(polypeptide(L)) [509 aa] BETA-CATENIN :CTNB1_MOUSE 171L(M) 172A(R) 173S(T) 177H(Y) 178I(T) 211A(L) 212L(H) 247D(E) 250E 251Q(G) 255T 283N(Y) 284E(K) 287G(M) 288M 291K(Q) 325D(Q) (identity: 17.6 %/27.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1i7w_A_1 identity=27.9%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1i7w_A_1     143:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 238
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeebeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :                                                     bbb   bb                                   bb  

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1i7w_A_1     239:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 330
SecStr          : S HH-----HHHHHHHHHHHH---HTT TT    HHHHHHHHHHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeebeebeebbbbbbebbebeeeebbbbbbbbbbebbeebeebbeebbeeebbebbbebbeebeeebebbeb:    
Contact         :                                b  bb   b                           bb  bb  b                       

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK: 395
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   ** :
1i7w_A_1     331:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR: 416
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSHHHHHHHHHTTHHHHHHHHHHHHHHHH  :    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------beeebbebbbebbebbbebeebbeebbeeebbebbbebbeebbeeeee:    
Contact         :            b                                                                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123