Protein Model on 1i7w_C_1_D_1 (TEMPLATE: 1i7w )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [509 aa] BETA-CATENIN :CTNB1_MOUSE
2 b D 1 (D) polymer(polypeptide(L)) [60 aa] EPITHELIAL-CADHERIN :CADH1_MOUSE 132D(N) 134S(K) 135P(F) 137Q(A) 138F(I) 141A(D) 149S(Y) 150G 155T(K) 179S(Y) 181Q(K) 184W 185A(T) 188N(R) 191G(K) 192D(V) 195V 197R(K) 231W 234S(R) 235N 241N(D) 244P(T) 273W(G) 276S 277Y(N) 279T 280D(C) 281G(N) 286I(K) 311T(E) 312P 318G(R) 319N(H) 323G(R) 361N(K) 368D(R) 369Q(N) (identity: 21.1 %/27.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1i7w_C_1 identity=27.8%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1i7w_C_1     143:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 238
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHHTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeebeebbeebeeeebbeebbebbee---eeeeebbbbbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :              b bb bb  b       bb    b                       b b  bb  b  bb  b    b                 

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1i7w_C_1     239:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 330
SecStr          : S HH-----HHHHHHHHHHHH---HTT TT SS HHHHHHHHHHTT S HHHHHHHHHHHHHHTTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebbeeeebeebbeebbebbeeeeeebbbbbbbbbbebbeebeebbebbbeeebbeebbebbeebeeebebbeb:    
Contact         :                b  bb     b  b                            b  bb bbb    b                          bb

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKE: 396
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **  :
1i7w_C_1     331:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRR: 417
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTTH-HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSHHHHHHHHHTTHHHHHHHHHHHHHHHHT  :    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------beeebbebbbbbbebbbebeebbeebeeeebbebbbebbeebbeeeeee:    
Contact         :     bb   b                                         b      bb                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123