Protein Model on 1i7x_C_1_D_1 (TEMPLATE: 1i7x )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [521 aa] BETA-CATENIN :CTNB1_MOUSE
2 b D 1 (D) polymer(polypeptide(L)) [63 aa] EPITHELIAL-CADHERIN :CADH1_MOUSE 149S(Y) 150G 155T(K) 191G(K) 192D(V) 195V 197R(K) 231W 234S(R) 235N 241N(D) 244P(T) 273W(G) 277Y(N) 279T 280D(C) 281G(N) 286I(K) 311T(E) 318G(R) 319N(H) 323G(R) 368D(R) 369Q(N) (identity: 20.8 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1i7x_C_1 identity=27.4%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1i7x_C_1     143:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 238
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHHT TTHHHHHHHHTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbbbbb-bbbbbbeebeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :                               bb    b                                   bb  b    b                 

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1i7x_C_1     239:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 330
SecStr          : S HH-----HHHHHHHHHHHH---HTT TT S THHHHHHHHHHTT S HHHHHHHHHHHHHHTSS HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeeeeebeebbbebbebbeeeeeebbbbbbbbbbebbeebeebbbebbeeebbebbbebbeebeeeeebbeb:    
Contact         :                b  bb     b  b                            b   b bbb    b                          b 

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW: 399
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
1i7x_C_1     331:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX: 422
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTTH-HHHHHHTTSTT-------  HHHHHHHHHHHHHHHTSGGGHHHHHHTTHHHHHHHHHHHHHHHTT ------:    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------bebebbebbbebbebbbebeebbeebeeeebbebbbebbeebbeeeee------:    
Contact         :     bb   b                                                bb                                       

queryA       400:AVTNYTSGGTVEQIV: 414
                :       *   * **:
1i7x_C_1     423:XXXXFVEGVRMEEIV: 437
SecStr          :---- BTTB HHHHH:    
ExpBur          :----eeeebebeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123